Perilipin-2 Recombinant monoclonal antibody, PBS Only (Capture)

Perilipin-2 Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA
Cat No. 80362-3-PBS
Clone No.230274D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

230274D9, ADFP, Adipophilin, Adipose differentiation-related protein, ADRP

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80362-3-PBS targets Perilipin-2 as part of a matched antibody pair:

MP00071-1: 80362-3-PBS capture and 80362-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7539

Product name: Recombinant human ADRP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 88-437 aa of BC005127

Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH

Predict reactive species
Full Name adipose differentiation-related protein
Calculated Molecular Weight 48 kDa
Observed Molecular Weight48 kDa
GenBank Accession NumberBC005127
Gene Symbol Perilipin-2
Gene ID (NCBI) 123
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99541
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases.

Loading...
||
New chat

Able

正在加载,请稍候...