AFF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AFF2 Polyclonal antibody, PBS Only (25414-1-PBS)

• 

  WB analysis using 25414-1-AP (same clone as 25414-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25414-1-AP (AFF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25414-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 25414-1-AP (same clone as 25414-1-PBS)

  IP result of anti-AFF2 (IP:25414-1-AP, 4ug; Detection:25414-1-AP 1:600) with SH-SY5Y cells lysate 1720 ug. This data was developed using the same antibody clone with 25414-1-PBS in a different storage buffer formulation.

AFF2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25414-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

AF4/FMR2 family member 2, FMR2, FMR2P, FRAXE, MRX2

---

Product Information

25414-1-PBS targets AFF2 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22225

  Product name: Recombinant human AFF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-263 aa of BC132683

  Sequence: LLTNHSNQNHLVGIPKNSVPQNPNNKNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKEDSNPNSSGEDAFKEIFQSNSPEESEFAVQAPGSPLVASSLLAPSSGLSV

• Full Name: AF4/FMR2 family, member 2
• Calculated Molecular Weight: 1311 aa, 145 kDa
• Observed Molecular Weight: 145 kDa
• GenBank Accession Number: BC132683
• Gene Symbol: AFF2
• Gene ID (NCBI): 2334
• RRID: AB_3742147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51816
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AFF2 (OMIM* 300806) (also known as FMR2 gene), which encodes AF4/FMR2 family member 2, is a transcriptional factor and RNA-binding protein that plays an important role in transcriptional regulation, RNA splicing, mRNA processing, and nuclear speckle organization . AFF2 is highly conserved and abundantly expressed in human brain, being essential for brain development. Homozygous AFF2 knock-out mice showed abnormal central nervous system synaptic transmission, abnormal excitatory postsynaptic potential, and premature death (PMID: 35431806).