AFM Monoclonal antibody

• 

  WB analysis of human plasma using 66113-1-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 66113-1-Ig (AFM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human plasma using 66113-1-Ig

  IP result of anti-AFM (IP:66113-1-Ig, 5ug; Detection:66113-1-Ig 1:500) with human plasma lysate 4000ug.

• 

  IHC staining of mouse brain using 66113-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66113-1-Ig (AFM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66113-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66113-1-Ig (AFM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 66113-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66113-1-Ig (AFM Antibody) at dilution of 1:50.

• 

  IHC staining of human liver using 66113-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66113-1-Ig (AFM Antibody) at dilution of 1:50.

• 

  IF Staining of HeLa using 66113-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using AFM antibody (66113-1-Ig, Clone: 2G9F6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

AFM Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66113-1-Ig

Clone No.2G9F6

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ALF, ALBA, ALB2, afamin/AFM, afamin

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IP detected in: human plasma tissue
• Positive IHC detected in: mouse brain tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66113-1-Ig targets AFM in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16866

  Product name: Recombinant human AFM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-599 aa of BC109020

  Sequence: SNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN

• Full Name: afamin
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC109020
• Gene Symbol: AFM
• Gene ID (NCBI): 173
• RRID: AB_2881512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43652
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AFM (Afamin) is a member of the albumin superfamily, which comprises albumin, vitamin D-binding protein, a-fetoprotein, and afamin. AFM is present in the plasma/serum, cerebrospinal fluid, and follicular fluid, and functions as a vitamin E-binding protein. Alterations of expression level of AFM have been linked to variety of diseases like cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	J Ginseng Res; A proteomic approach reveals the differential protein expression in Drosophila melanogaster treated with red ginseng extract (Panax ginseng); Authors - Qing-Xiu Liu