CoraLite®594-conjugated AFM Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66113

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 AFM antibody (CL594-66113, Clone: 2G9F6 ) at dilution of 1:200.

• 

  IF Staining of HeLa using CL594-66113

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 AFM antibody (CL594-66113, Clone: 2G9F6 ) at dilution of 1:100.

AFM Monoclonal Antibody for IF/ICC

Cat No. CL594-66113

Clone No.2G9F6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

ALF, ALBA, ALB2, afamin/AFM, afamin

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66113 targets AFM in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16866

  Product name: Recombinant human AFM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-599 aa of BC109020

  Sequence: SNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN

• Full Name: afamin
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC109020
• Gene Symbol: AFM
• Gene ID (NCBI): 173
• RRID: AB_2883514
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43652
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

AFM (Afamin) is a member of the albumin superfamily, which comprises albumin, vitamin D-binding protein, a-fetoprotein, and afamin. AFM is present in the plasma/serum, cerebrospinal fluid, and follicular fluid, and functions as a vitamin E-binding protein. Alterations of expression level of AFM have been linked to variety of diseases like cancer.