AGAP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AGAP3 Polyclonal antibody, PBS Only (27681-1-PBS)

• 

  WB analysis using 27681-1-AP (same clone as 27681-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27681-1-AP (AGAP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27681-1-PBS in a different storage buffer formulation.

AGAP3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27681-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

AGAP-3, Centaurin gamma 3, CENTG3, CRAG, MRIP-1

---

Product Information

27681-1-PBS targets AGAP3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26662

  Product name: Recombinant human AGAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 474-556 aa of BC044644

  Sequence: LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT

• Full Name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC044644
• Gene Symbol: AGAP3
• Gene ID (NCBI): 116988
• RRID: AB_3742246
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P47
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AGAP3, also known as MRIP-1, CENTG3, contains multiple signaling domains, a GTPase-like domain, a pleckstrin homology domain, and an ArfGAP domain, and exists as a component of the NMDA receptor complex. AGAP3 is a component of the NMDA receptor complex that regulates Arf6 and Ras/ERK signaling (PMID: 23904596).