AGER/RAGE Monoclonal antibody

• 

  WB analysis of pig lung using 66833-1-Ig

  pig lung tissue were subjected to SDS PAGE followed by western blot with 66833-1-Ig (AGER antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat lung using 66833-1-Ig

  rat lung tissue were subjected to SDS PAGE followed by western blot with 66833-1-Ig (AGER antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung using 66833-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66833-1-Ig (AGER antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 66833-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66833-1-Ig (AGER antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 66833-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 66833-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat lung using 66833-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using AGER antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AGER/RAGE Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66833-1-Ig

Clone No.3D4G11

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

AGER, RAGE, 3D4G11, Advanced glycosylation end product-specific receptor

---

Tested Applications

• Positive WB detected in: pig lung tissue, rat lung tissue
• Positive IHC detected in: human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat lung tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

66833-1-Ig targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9657

  Product name: Recombinant human AGER protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-340 aa of BC020669

  Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• RRID: AB_2882176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a multiligand receptor of the immunoglobulin superfamily. It interacts with distinct molecules implicated in homeostasis, development, and inflammation, and certain diseases such as diabetes and Alzheimer disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Biomolecules; Evaluation of the Effects of Thymoquinone on RAGE/NOX4 Expressions and Brain Tissue Morphometry in Experimental Alzheimer's Disease Induced by Amyloid Beta 1-42 Peptide; Authors - Şükrü Ateş
mouse	WB	Cell Signal; Dapagliflozin alleviates advanced glycation end product induced podocyte injury through AMPK/mTOR mediated autophagy pathway; Authors - Lei Yang
human	WB	Mol Immunol; S100A11 regulates nasal epithelial cell remodeling and inflammation in CRSwNPs via the RAGE-mediated AMPK-STAT3 pathway.; Authors - Chengcheng Liu
rat	WB	J Ethnopharmacol; Zhongfeng Decoction attenuates cerebral ischemia-reperfusion injury by inhibiting autophagy via regulating the AGE-RAGE signaling pathway; Authors - Weitao Wang