AGER/RAGE Monoclonal antibody

• Home
• Products
• Primary Antibodies
• AGER/RAGE Monoclonal antibody (66833-1-Ig)

AGER/RAGE Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66833-1-Ig Copied!

Clone No. 3D4G11

Publications (13)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

AGER, RAGE, 3D4G11, Advanced glycosylation end product-specific receptor

• 

  WB analysis of pig lung using 66833-1-Ig

  pig lung tissue were subjected to SDS PAGE followed by western blot with 66833-1-Ig (AGER antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat lung using 66833-1-Ig

  rat lung tissue were subjected to SDS PAGE followed by western blot with 66833-1-Ig (AGER antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 66833-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66833-1-Ig (AGER antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 66833-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66833-1-Ig (AGER antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 66833-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 66833-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat lung using 66833-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using AGER antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AGER/RAGE in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig lung tissue, rat lung tissue
• Positive IHC detected in: human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat lung tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66833-1-Ig targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9657

  Product name: Recombinant human AGER protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-340 aa of BC020669

  Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• RRID: AB_2882176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a multiligand receptor of the immunoglobulin superfamily. It interacts with distinct molecules implicated in homeostasis, development, and inflammation, and certain diseases such as diabetes and Alzheimer disease.

Publications

What published studies show

RAGE antibody (Cat# 66833-1-Ig) has 13 total citations published across journals including J Ethnopharmacol, Int Immunopharmacol, Biomolecules, Cell Oncology, Cell Signaling, Genes & Immunity, Molecular Immunology, Biochemical & Biophysical Reports, IBRO Neuroscience Reports, and Applied Biochemistry and Biotechnology. Research fields span rheumatoid arthritis, cerebral ischemia-reperfusion injury, hypertensive nephropathy, NAFLD, gastric ulcer, Alzheimer's disease, triple-negative breast cancer, podocyte injury, pulmonary fibrosis, nasal inflammation, nerve regeneration, and diabetic nephropathy.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	J Ethnopharmacol; Siwei Zangmu Xiang alleviates rheumatoid arthritis via regulating RAGE signaling pathway: Integration of UPLC-Q-TOF-MS, network pharmacology, and in vivo/in vitro studies.; Authors - Bao Hou
mouse	WB	J Ethnopharmacol; Huanglian Jiedu Decoction ameliorates Hypertensive Nephropathy by inhibiting the AGEs-RAGE/MAPK/AP-1 axis: An integrated transcriptomics and network pharmacology study.; Authors - Ning Wang
rat	WB,IHC	J Ethnopharmacol; Qinggan Jiangzhi Cha ameliorates NAFLD by modulating the AGE-RAGE/PRKCA/MAPK3/AP-1 signaling axis.; Authors - Yu Bai
rat	WB	J Ethnopharmacol; Zhongfeng Decoction attenuates cerebral ischemia-reperfusion injury by inhibiting autophagy via regulating the AGE-RAGE signaling pathway; Authors - Weitao Wang
		Int Immunopharmacol; A novel triazole derivative ameliorates ethanol-induced gastric ulcer via a NOS2-centered inhibition of the AGE-RAGE pathway.; Authors - Cong Xie
mouse	WB,IHC	Biomolecules; Evaluation of the Effects of Thymoquinone on RAGE/NOX4 Expressions and Brain Tissue Morphometry in Experimental Alzheimer's Disease Induced by Amyloid Beta 1-42 Peptide; Authors - Şükrü Ateş