AGER/RAGE Monoclonal antibody, PBS Only

• 

  WB analysis of pig lung using 66833-1-Ig (same clone as 66833-1-PBS)

  pig lung tissue were subjected to SDS PAGE followed by western blot with 66833-1-Ig (AGER antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat lung using 66833-1-Ig (same clone as 66833-1-PBS)

  rat lung tissue were subjected to SDS PAGE followed by western blot with 66833-1-Ig (AGER antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 66833-1-Ig (same clone as 66833-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66833-1-Ig (AGER antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 66833-1-Ig (same clone as 66833-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66833-1-Ig (AGER antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 66833-1-Ig (same clone as 66833-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 66833-1-Ig (same clone as 66833-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat lung using 66833-1-Ig (same clone as 66833-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using AGER antibody (66833-1-Ig, Clone: 3D4G11 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66833-1-PBS in a different storage buffer formulation.

AGER/RAGE Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66833-1-PBS

Clone No.3D4G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

AGER, RAGE, 3D4G11, Advanced glycosylation end product-specific receptor

---

Product Information

66833-1-PBS targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9657

  Product name: Recombinant human AGER protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-340 aa of BC020669

  Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• RRID: AB_2882176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a multiligand receptor of the immunoglobulin superfamily. It interacts with distinct molecules implicated in homeostasis, development, and inflammation, and certain diseases such as diabetes and Alzheimer disease.