CoraLite® Plus 488-conjugated AGER/RAGE Monoclonal antibody

• 

  WB analysis using CL488-66833

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66833 (AGER antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse lung using CL488-66833

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using CoraLite® Plus 488 AGER/RAGE antibody (CL488-66833, Clone: 3D4G11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using CL488-66833

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using CoraLite® Plus 488 AGER/RAGE antibody (CL488-66833, Clone: 3D4G11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat lung using CL488-66833

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using CoraLite® Plus 488 AGER antibody (CL488-66833, Clone: 3D4G11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AGER/RAGE Monoclonal Antibody for WB, IF-P

Cat No. CL488-66833

Clone No.3D4G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF-P

Synonyms

AGER, RAGE, 3D4G11, Advanced glycosylation end product-specific receptor

---

Tested Applications

• Positive WB detected in: pig lung tissue
• Positive IF-P detected in: rat lung tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66833 targets AGER/RAGE in WB, IF-P applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9657

  Product name: Recombinant human AGER protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-340 aa of BC020669

  Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 43, 50 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• RRID: AB_3672924
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a multiligand receptor of the immunoglobulin superfamily. It interacts with distinct molecules implicated in homeostasis, development, and inflammation, and certain diseases such as diabetes and Alzheimer disease.