AGER/RAGE Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse lung using 85349-1-RR (same clone as 85349-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 85349-1-RR (AGER/RAGE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85349-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig lung using 85349-1-RR (same clone as 85349-1-PBS)

  pig lung tissue were subjected to SDS PAGE followed by western blot with 85349-1-RR (AGER/RAGE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85349-1-PBS in a different storage buffer formulation.

• 

  Affinity of 85349-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85349-1-RR against Human AGER/RAGE were performed. The affinity constant is 0.489 nM.

AGER/RAGE Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85349-1-PBS

Clone No.242714G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, Indirect ELISA

Synonyms

AGER, RAGE, 242714G12, Advanced glycosylation end product-specific receptor

---

Product Information

85349-1-PBS targets AGER/RAGE in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3860

  Product name: Recombinant Human AGER/RAGE protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-342 aa of BC020669

  Sequence: AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The receptor for advanced glycation end products (RAGE) is a cell surface transmembrane multiligand receptor, also known as Ager, is a multiligand member of the immunoglobulin superfamily. It has many isoforms and is predominantly expressed in the lung. AGER expression is upregulated in many diseases such as Alzheimer's disease, diabetes mellitus, atherosclerosis, and rheumatoid arthritis (PMID: 35099614).