AGMAT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AGMAT Polyclonal antibody, PBS Only (21899-1-PBS)

• 

  WB analysis using 21899-1-AP (same clone as 21899-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21899-1-AP (AGMAT antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21899-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21899-1-AP (same clone as 21899-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21899-1-AP (AGMAT antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21899-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 21899-1-AP (same clone as 21899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21899-1-AP (AGMAT antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21899-1-PBS in a different storage buffer formulation.

AGMAT Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21899-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Agmatinase, Arginase, mitochondrial, Agmatine ureohydrolase

---

Product Information

21899-1-PBS targets AGMAT in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13609

  Product name: Recombinant human AGMAT protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-300 aa of BC005090

  Sequence: MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ

• Full Name: agmatine ureohydrolase (agmatinase)
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC005090
• Gene Symbol: AGMAT
• Gene ID (NCBI): 79814
• RRID: AB_3085677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AGMAT is a metallohydrolase and belongs to the arginase family. AGMAT plays an important role in amino acid metabolism and can hydrolyze agmatine into urea and putrescine. AGMAT has been shown to play an important role in the development of tumors, including colorectal cancer, lung adenocarcinoma, and pancreatic adenocarcinoma(PMID: 36680755; PMID: 31699997; PMID: 35837051 ).