AIF Recombinant monoclonal antibody, PBS Only (Detector)

AIF Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 86156-1-PBS
Clone No.250772G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test

AIFM1, Apoptosis-inducing factor 1, mitochondrial, EC:1.6.99.-, PDCD8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86156-1-PBS targets AIF as part of a matched antibody pair:

MP02287-1: 86156-2-PBS capture and 86156-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13268

Product name: Recombinant human AIF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 259-609 aa of BC111065

Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Predict reactive species
Full Name apoptosis-inducing factor, mitochondrion-associated, 1
Calculated Molecular Weight 609 aa, 66 kDa
Observed Molecular Weight67 kDa
GenBank Accession NumberBC111065
Gene Symbol AIF
Gene ID (NCBI) 9131
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95831
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID:19332058).

Loading...
||
New chat Able
正在加载,请稍候...