AIF Recombinant monoclonal antibody

• 

  WB analysis using 86156-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86156-1-RR (AIF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86156-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AIF antibody (86156-1-RR, Clone: 250772G11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86156-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86156-1-RR against Human AIF were performed. The affinity constant is 3.18 nM.

AIF Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86156-1-RR

Clone No.250772G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

AIFM1, Apoptosis-inducing factor 1, mitochondrial, EC:1.6.99.-, PDCD8

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, Jurkat cells, K-562 cells, NIH/3T3 cells, C2C12 cells, C6 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86156-1-RR targets AIF in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13268

  Product name: Recombinant human AIF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 259-609 aa of BC111065

  Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 1
• Calculated Molecular Weight: 609 aa, 66 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC111065
• Gene Symbol: AIF
• Gene ID (NCBI): 9131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID:19332058).