AIFM2/ FSP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68049-1-Ig (same clone as 68049-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 68049-1-Ig (same clone as 68049-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCI-H1299 using 68049-1-Ig (same clone as 68049-1-PBS)

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68049-1-Ig (same clone as 68049-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68049-1-Ig (same clone as 68049-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 68049-1-Ig (same clone as 68049-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 68049-1-Ig (same clone as 68049-1-PBS)

  IP result of anti-AIFM2/ FSP1 (IP:68049-1-Ig, 4ug; Detection:68049-1-Ig 1:500) with K-562 cells lysate 1760 ug. This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 68049-1-Ig (same clone as 68049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68049-1-Ig (AIFM2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 68049-1-Ig (same clone as 68049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68049-1-Ig (AIFM2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  IF Staining of H9C2 using 68049-1-Ig (same clone as 68049-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using AIFM2/ FSP1 antibody (68049-1-Ig, Clone: 1A2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  IF Staining of H9C2 using 68049-1-Ig (same clone as 68049-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using AIFM2/ FSP1 antibody (68049-1-Ig, Clone: 1A2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 68049-1-Ig (same clone as 68049-1-PBS)

  1X10^6 K-562 cells were intracellularly stained with 0.5 ug Anti-Human AIFM2 (68049-1-Ig, Clone:1A2B2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 68049-1-PBS in a different storage buffer formulation.

AIFM2/ FSP1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 68049-1-PBS

Clone No.1A2B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

AIFM2, AMID, FSP1, 1A2B2, AIFM 2

---

Product Information

68049-1-PBS targets AIFM2/ FSP1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30516

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2918791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.