AIFM2/ FSP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• AIFM2/ FSP1 Monoclonal antibody (68049-1-Ig)

AIFM2/ FSP1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 68049-1-Ig Copied!

Clone No. 1A2B2

Publications (20)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

AIFM2, AMID, FSP1, 1A2B2, AIFM 2

• 

  WB analysis using 68049-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2/ FSP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68049-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 68049-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCI-H1299 using 68049-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 68049-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 68049-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 68049-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 68049-1-Ig

  IP result of anti-AIFM2/ FSP1 (IP:68049-1-Ig, 4ug; Detection:68049-1-Ig 1:500) with K-562 cells lysate 1760 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 68049-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68049-1-Ig (AIFM2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 68049-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68049-1-Ig (AIFM2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of H9C2 using 68049-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using AIFM2/ FSP1 antibody (68049-1-Ig, Clone: 1A2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of H9C2 using 68049-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using AIFM2/ FSP1 antibody (68049-1-Ig, Clone: 1A2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of K-562 using 68049-1-Ig

  1X10^6 K-562 cells were intracellularly stained with 0.5 ug Anti-Human AIFM2 (68049-1-Ig, Clone:1A2B2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AIFM2/ FSP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LoVo cells, A549 cells, HEK-293 cells, HepG2 cells, K-562 cells, MCF-7 cells, NCI-H1299 cells, L02 cells, RKO cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: H9C2 cells
• Positive FC (Intra) detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68049-1-Ig targets AIFM2/ FSP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30516

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2918791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Publications

What published studies show

The AIFM2/FSP1 Monoclonal antibody (Cat# 68049-1-Ig) has 20 citations. Publications appear in Nature, Science, Nat Commun, Sci Adv, Redox Biol, Adv Sci, Cell Death Discov, J Adv Res, Free Radic Biol Med, Phytomedicine, Antioxidants, Front Pharmacol, Cell Signal, Exp Cell Res, Research, and Transl Androl Urol. Research fields center on ferroptosis mechanisms, cancer biology (melanoma, breast, gastric, renal, liver, bladder, lymphoma, medulloblastoma), oxidative stress, acute kidney injury, osteoporosis, obesity, and cardiac dysfunction.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nature; Lymph node environment drives FSP1 targetability in metastasizing melanoma; Authors - Mario Palma
mouse,human	WB	Nat Commun; Iron overload in the tumor microenvironment induces CD8(+) T cell ferroptosis and dysfunction.; Authors - Zhenyu Lin
mouse	WB	J Adv Res; Asperosaponin VI inhibition of DNMT alleviates GPX4 suppression-mediated osteoblast ferroptosis and diabetic osteoporosis; Authors - Fanhao Wei
mouse	WB	Redox Biol; SENP3 sensitizes macrophages to ferroptosis via de-SUMOylation of FSP1; Authors - Xuelian Chen
mouse	WB	Redox Biol; The role and mechanism of the cGAS-STING pathway-mediated ROS in apoptosis and ferroptosis induced by manganese exposure.; Authors - Zhimin Zhang
mouse,human	WB	Adv Sci (Weinh); Inhibition of Calcium-Dependent Lipid Droplets Relocation of ACSL4-PKCβ-ALOX15 Complex Alleviates Ferroptosis and Acute Pancreatitis.; Authors - Guoyuan Hou