AIFM2/ FSP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• AIFM2/ FSP1 Monoclonal antibody (68049-1-Ig)

AIFM2/ FSP1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 68049-1-Ig

Clone No.1A2B2

Publications(17)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

AIFM2, AMID, FSP1, 1A2B2, AIFM 2

• 

  WB analysis using 68049-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2/ FSP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68049-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 68049-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCI-H1299 using 68049-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 68049-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 68049-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 68049-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 68049-1-Ig (AIFM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 68049-1-Ig

  IP result of anti-AIFM2/ FSP1 (IP:68049-1-Ig, 4ug; Detection:68049-1-Ig 1:500) with K-562 cells lysate 1760 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 68049-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68049-1-Ig (AIFM2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 68049-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68049-1-Ig (AIFM2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of H9C2 using 68049-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using AIFM2/ FSP1 antibody (68049-1-Ig, Clone: 1A2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of H9C2 using 68049-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using AIFM2/ FSP1 antibody (68049-1-Ig, Clone: 1A2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of K-562 using 68049-1-Ig

  1X10^6 K-562 cells were intracellularly stained with 0.5 ug Anti-Human AIFM2 (68049-1-Ig, Clone:1A2B2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: LoVo cells, A549 cells, HEK-293 cells, HepG2 cells, K-562 cells, MCF-7 cells, NCI-H1299 cells, L02 cells, RKO cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: H9C2 cells
• Positive FC (Intra) detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68049-1-Ig targets AIFM2/ FSP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30516

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2918791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Exp Cell Res; Protocadherin 17 weakens the lenvatinib resistance of liver cancer through inducing ferroptosis; Authors - Jun Yang
rat,human	WB	Front Pharmacol; Combination decoction of Astragalus mongholicus and Salvia miltiorrhiza mitigates pressure-overload cardiac dysfunction by inhibiting multiple ferroptosis pathways; Authors - Qiyao Xu
mouse	WB	Redox Biol; The role and mechanism of the cGAS-STING pathway-mediated ROS in apoptosis and ferroptosis induced by manganese exposure.; Authors - Zhimin Zhang
mouse	WB	J Adv Res; Asperosaponin VI inhibition of DNMT alleviates GPX4 suppression-mediated osteoblast ferroptosis and diabetic osteoporosis; Authors - Fanhao Wei
mouse	IHC,IF	Cell Signal; Regulating the GTP cyclohydrolase 1/tetrahydrobiopterin axis in the distal tubule inhibits ferroptosis and alleviates crush syndrome-related acute kidney injury in mice.; Authors - Li Zhang
human		Sci Adv; Metabolic rewiring driven by phosphoglycolate phosphatase deletion inhibits ferroptosis.; Authors - Marian Brenner