AIFM2/ FSP1 Recombinant monoclonal antibody

• 

  WB analysis using 82974-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82974-1-RR (AIFM2/ FSP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 82974-1-RR

  IP result of anti-AIFM2/ FSP1 (IP:82974-1-RR, 4ug; Detection:82974-1-RR 1:3000) with HepG2 cells lysate 1085 ug.

• 

  FC experiment of A549 using 82974-1-RR

  1x10^6 A549 cells were intracellularly stained with 0.25 ug AIFM2/ FSP1 Recombinant antibody (82974-1-RR, Clone:2J1) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 82974-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82974-1-RR against Human AIFM2/ FSP1 were performed. The affinity constant is below 1 pM.

AIFM2/ FSP1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), IP, ELISA

Cat No. 82974-1-RR

Clone No.2J1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), IP, ELISA

Synonyms

AIFM2, AMID, FSP1, 2J1, AIFM 2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82974-1-RR targets AIFM2/ FSP1 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13412

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_3670722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.