AIRE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AIRE Polyclonal antibody (22517-1-AP)

• KD/KO Validated

AIRE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22517-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AIRE1, APECED, APS1, APSI, PGA1

• 

  WB analysis of L02 using 22517-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human spleen using 22517-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 22517-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human plasma using 22517-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 22517-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thymus using 22517-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22517-1-AP (AIRE Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thymus using 22517-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22517-1-AP (AIRE Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 22517-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 22517-1-AP (AIRE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AIRE in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, human plasma tissue, human spleen tissue, mouse thymus tissue, U-937 cells
• Positive IHC detected in: human thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22517-1-AP targets AIRE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18249

  Product name: Recombinant human AIRE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-348 aa of BC137270

  Sequence: QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

• Full Name: autoimmune regulator
• Calculated Molecular Weight: 545 aa, 58 kDa
• Observed Molecular Weight: 58-69 kDa
• GenBank Accession Number: BC137270
• Gene Symbol: AIRE
• Gene ID (NCBI): 326
• RRID: AB_2879113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O43918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The function of the protein is not well defined, however it contains zinc finger motifs suggestive of a transcription factor. The protein (isoform 1) is localized to both the nucleus and cytoplasm. Three splice variant mRNAs products have been described [1]. The longer AIRE1 mRNA appears to be more abundant and includes exons 1 through 14. Splice variant AIRE2 includes a portion of the non-coding region of exon 1, an alternatively spliced longer exon 8, plus exons 9 through 14. Variant AIRE3 includes the same exon 1-8-9 sequences as found in AIRE2 but utilizes additional alternative splicing in exon 10 that shifts the reading frame such that a stop codon in exon 12 is utilized. The resulting protein products of these splice variants differ significantly. Defects in this gene cause the autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED).

Publications

What published studies show

The AIRE antibody (catalog no. 22517-1-AP) has 6 citations. They appear in Nature Immunology, Nature Communications, Frontiers in Pharmacology, Biochemistry (Moscow), Tumori, and Research Square. Research fields span central immune tolerance, thymic epithelial cell biology, aging, and cancer immunotherapy, including AIRE's role in lung squamous cell carcinoma and tumor epitope conditioning. Applications include WB, IF, and IHC in human and mouse.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; Chd4 choreographs self-antigen expression for central immune tolerance.; Authors - Yoshihiko Tomofuji
human	IF	Nat Commun; The immune landscape of human thymic epithelial tumors; Authors - Zhongwei Xin
mouse	IHC	Front Pharmacol; Protective effects of Ganoderma lucidum spores on estradiol benzoate-induced TEC apoptosis and compromised double-positive thymocyte development; Authors - Jihong Yang
mouse	WB	Biochemistry (Mosc); Defective Central Immune Tolerance Induced by High-Dose D-Galactose Resembles Aging.; Authors - H M Du
human	WB,IHC	Tumori; Nuclear expression of AIRE in lung squamous cell carcinoma correlates with immune microenvironment remodeling and poor prognosis.; Authors - Chengyan Wang
mouse	WB	Res Sq; Cancer Immunotherapy Using AIRE Conditioning of the Tumor Epitopeome; Authors - Richard Vile