AIRE Polyclonal antibody

• 

  WB analysis of L02 using 22517-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 22517-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 22517-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 22517-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 22517-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thymus using 22517-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22517-1-AP (AIRE Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thymus using 22517-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22517-1-AP (AIRE Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 22517-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 22517-1-AP (AIRE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

AIRE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22517-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PGA1, APSI, APS1, APECED, AIRE1

---

Tested Applications

• Positive WB detected in: L02 cells, human plasma tissue, human spleen tissue, mouse thymus tissue, U-937 cells
• Positive IHC detected in: human thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

22517-1-AP targets AIRE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18249

  Product name: Recombinant human AIRE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-348 aa of BC137270

  Sequence: QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

• Full Name: autoimmune regulator
• Calculated Molecular Weight: 545 aa, 58 kDa
• Observed Molecular Weight: 58-69 kDa
• GenBank Accession Number: BC137270
• Gene Symbol: AIRE
• Gene ID (NCBI): 326
• RRID: AB_2879113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O43918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The function of the protein is not well defined, however it contains zinc finger motifs suggestive of a transcription factor. The protein (isoform 1) is localized to both the nucleus and cytoplasm. Three splice variant mRNAs products have been described [1]. The longer AIRE1 mRNA appears to be more abundant and includes exons 1 through 14. Splice variant AIRE2 includes a portion of the non-coding region of exon 1, an alternatively spliced longer exon 8, plus exons 9 through 14. Variant AIRE3 includes the same exon 1-8-9 sequences as found in AIRE2 but utilizes additional alternative splicing in exon 10 that shifts the reading frame such that a stop codon in exon 12 is utilized. The resulting protein products of these splice variants differ significantly. Defects in this gene cause the autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; Chd4 choreographs self-antigen expression for central immune tolerance.; Authors - Yoshihiko Tomofuji
mouse	WB	Biochemistry (Mosc); Defective Central Immune Tolerance Induced by High-Dose D-Galactose Resembles Aging.; Authors - H M Du
mouse	WB	Res Sq; Cancer Immunotherapy Using AIRE Conditioning of the Tumor Epitopeome; Authors - Richard Vile
human	IF	Nat Commun; The immune landscape of human thymic epithelial tumors; Authors - Zhongwei Xin
mouse	IHC	Front Pharmacol; Protective effects of Ganoderma lucidum spores on estradiol benzoate-induced TEC apoptosis and compromised double-positive thymocyte development; Authors - Jihong Yang