AIRE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AIRE Polyclonal antibody, PBS Only (22517-1-PBS)

• 

  WB analysis of L02 using 22517-1-AP (same clone as 22517-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 22517-1-AP (same clone as 22517-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 22517-1-AP (same clone as 22517-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 22517-1-AP (same clone as 22517-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 22517-1-AP (same clone as 22517-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 22517-1-AP (AIRE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thymus using 22517-1-AP (same clone as 22517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22517-1-AP (AIRE Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thymus using 22517-1-AP (same clone as 22517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22517-1-AP (AIRE Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22517-1-AP (same clone as 22517-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 22517-1-AP (AIRE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22517-1-PBS in a different storage buffer formulation.

AIRE Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 22517-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

22517-1-PBS targets AIRE in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18249

  Product name: Recombinant human AIRE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-348 aa of BC137270

  Sequence: QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

• Full Name: autoimmune regulator
• Calculated Molecular Weight: 545 aa, 58 kDa
• Observed Molecular Weight: 58-69 kDa
• GenBank Accession Number: BC137270
• Gene Symbol: AIRE
• Gene ID (NCBI): 326
• RRID: AB_2879113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O43918
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The function of the protein is not well defined, however it contains zinc finger motifs suggestive of a transcription factor. The protein (isoform 1) is localized to both the nucleus and cytoplasm. Three splice variant mRNAs products have been described [1]. The longer AIRE1 mRNA appears to be more abundant and includes exons 1 through 14. Splice variant AIRE2 includes a portion of the non-coding region of exon 1, an alternatively spliced longer exon 8, plus exons 9 through 14. Variant AIRE3 includes the same exon 1-8-9 sequences as found in AIRE2 but utilizes additional alternative splicing in exon 10 that shifts the reading frame such that a stop codon in exon 12 is utilized. The resulting protein products of these splice variants differ significantly. Defects in this gene cause the autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED).