AK2 Polyclonal antibody

• 

  WB analysis using 11014-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11014-1-AP (AK2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 11014-1-AP

  IP result of anti-AK2 (IP:11014-1-AP, 3ug; Detection:11014-1-AP 1:800) with mouse liver tissue lysate 12500ug.

• 

  IHC staining of human pancreas cancer using 11014-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11014-1-AP (AK2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 11014-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11014-1-AP (AK2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 11014-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using AK2 antibody (11014-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

AK2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11014-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ATP-AMP transphosphorylase 2, ATP:AMP phosphotransferase, ADK2, Adenylate monophosphate kinase, Adenylate kinase 2, mitochondrial, N-terminally processed

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, HepG2 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

11014-1-AP targets AK2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1464

  Product name: Recombinant human AK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC009405

  Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYR

• Full Name: adenylate kinase 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC009405
• Gene Symbol: AK2
• Gene ID (NCBI): 204
• RRID: AB_2305358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54819
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AK2(Adenylate kinase 2, mitochondrial ) is also named as ADK2 and belongs to the adenylate kinase family. It plays a unique role in energy metabolism and energy transfer by regulating the ATP/ADP rate between the cytoplasma matrix and the mitochondria and it is increased expression during adipocyte and B cell differentiation(PMID:23020757). AK2 catalyzes the reversible transfer of a phosphoryl group from ATP to AMP(PMID:19043417). Defects in AK2 are the cause of reticular dysgenesis (RDYS)(PMID:19043416). It has 6 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	IHC	Nat Genet; Reticular dysgenesis (aleukocytosis) is caused by mutations in the gene encoding mitochondrial adenylate kinase 2.; Authors - Pannicke Ulrich U
human	WB,IF	Blood; The palmitoyltransferase ZDHHC21 regulates oxidative phosphorylation to induce differentiation block and stemness in AML; Authors - Xuejing Shao
human	WB	Neuron; Loss of PYCR2 Causes Neurodegeneration by Increasing Cerebral Glycine Levels via SHMT2.; Authors - Nathalie Escande-Beillard
human	WB	J Exp Med; A loss-of-function NUAK2 mutation in humans causes anencephaly due to impaired Hippo-YAP signaling.; Authors - Carine Bonnard
human	WB	EMBO Mol Med; A progeroid syndrome caused by a deep intronic variant in TAPT1 is revealed by RNA/SI-NET sequencing; Authors - Nasrinsadat Nabavizadeh
human	WB,IF	Fluids Barriers CNS; Cocaine regulates antiretroviral therapy CNS access through pregnane-x receptor-mediated drug transporter and metabolizing enzyme modulation at the blood brain barrier; Authors - Rodnie Colón Ortiz