CoraLite® Plus 488-conjugated AK2 Polyclonal antibody

AK2 Polyclonal Antibody for IF/ICC
Cat No. CL488-11014

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

adenylate kinase 2, ADK2, AK 2, AK2, ATP AMP transphosphorylase 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11014 targets AK2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1464

Product name: Recombinant human AK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-202 aa of BC009405

Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYR

Predict reactive species
Full Name adenylate kinase 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC009405
Gene Symbol AK2
Gene ID (NCBI) 204
RRIDAB_3672478
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP54819
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AK2(Adenylate kinase 2, mitochondrial ) is also named as ADK2 and belongs to the adenylate kinase family. It plays a unique role in energy metabolism and energy transfer by regulating the ATP/ADP rate between the cytoplasma matrix and the mitochondria and it is increased expression during adipocyte and B cell differentiation(PMID:23020757). AK2 catalyzes the reversible transfer of a phosphoryl group from ATP to AMP(PMID:19043417). Defects in AK2 are the cause of reticular dysgenesis (RDYS)(PMID:19043416). It has 6 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 AK2 antibody CL488-11014Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...