• Featured Product
  • KD/KO Validated

AK2 Monoclonal antibody, PBS Only (Capture)

AK2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66127-1-PBS
Clone No.3H2C10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

3H2C10, adenylate kinase 2, Adenylate kinase 2, mitochondrial, N-terminally processed, Adenylate monophosphate kinase, ADK2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66127-1-PBS targets AK2 as part of a matched antibody pair:

MP50407-1: 66127-1-PBS capture and 66127-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17911

Product name: Recombinant human AK2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-202 aa of BC009405

Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYR

Predict reactive species
Full Name adenylate kinase 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC009405
Gene Symbol AK2
Gene ID (NCBI) 204
RRIDAB_2881526
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54819
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AK2(Adenylate kinase 2, mitochondrial ) is also named as ADK2 and belongs to the adenylate kinase family. It plays a unique role in energy metabolism and energy transfer by regulating the ATP/ADP rate between the cytoplasma matrix and the mitochondria and it is increased expression during adipocyte and B cell differentiation(PMID:23020757). AK2 catalyzes the reversible transfer of a phosphoryl group from ATP to AMP(PMID:19043417). Defects in AK2 are the cause of reticular dysgenesis (RDYS)(PMID:19043416). It has 6 isoforms produced by alternative splicing.

Loading...
||
New chat

Able

正在加载,请稍候...