AKAP10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AKAP10 Polyclonal antibody, PBS Only (12356-1-PBS)

• 

  WB analysis using 12356-1-AP (same clone as 12356-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12356-1-AP (AKAP10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12356-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12356-1-AP (same clone as 12356-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12356-1-AP (AKAP10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12356-1-AP (same clone as 12356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12356-1-AP (same clone as 12356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12356-1-AP (same clone as 12356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12356-1-AP (same clone as 12356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 12356-1-AP (AKAP10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12356-1-PBS in a different storage buffer formulation.

AKAP10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12356-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12356-1-PBS targets AKAP10 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3020

  Product name: Recombinant human AKAP10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 314-663 aa of BC017055

  Sequence: IPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGSSDSSASQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDIMQQAQYDQPLEKSTKL

• Full Name: A kinase (PRKA) anchor protein 10
• Calculated Molecular Weight: 662 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC017055
• Gene Symbol: AKAP10
• Gene ID (NCBI): 11216
• RRID: AB_2225588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43572
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.