AKAP7 Polyclonal antibody, PBS Only

Name: AKAP7 Polyclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 12591-1-PBS-100UG

AKAP7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12591-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

A kinase anchor protein 18 kDa, AKAP 18, AKAP 7 isoforms alpha and beta, AKAP18, AKAP-7 isoforms alpha and beta

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of human brain using 12591-1-AP (same clone as 12591-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 12591-1-AP (AKAP7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 12591-1-AP (same clone as 12591-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 12591-1-AP (AKAP7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 12591-1-AP (same clone as 12591-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 12591-1-AP (AKAP7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12591-1-AP (same clone as 12591-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12591-1-AP (AKAP7 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12591-1-AP (same clone as 12591-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12591-1-AP (AKAP7 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 12591-1-AP (same clone as 12591-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12591-1-AP (AKAP7 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 12591-1-AP (same clone as 12591-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12591-1-AP (AKAP7 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 12591-1-AP (same clone as 12591-1-PBS)
Immunofluorescent analysis of HepG2 cells, using AKAP7 antibody 12591-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 12591-1-PBS in a different storage buffer formulation.

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12591-1-PBS targets AKAP7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3297 Product name: Recombinant human AKAP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC016927 Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK Predict reactive species
Full Name	A kinase (PRKA) anchor protein 7
Calculated Molecular Weight	81 aa, 9 kDa
Observed Molecular Weight	11 kDa, 18 kDa, 37 kDa
GenBank Accession Number	BC016927
Gene Symbol	AKAP7
Gene ID (NCBI)	9465
RRID	AB_2226037
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O43687
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

AKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 9-15 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals. This antibody can recognize all the isoforms of AKAP7.