AKR1CL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AKR1CL2 Polyclonal antibody, PBS Only (20525-1-PBS)

• 

  WB analysis of mouse testis using 20525-1-AP (same clone as 20525-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20525-1-AP (AKR1CL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20525-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW264.7 using 20525-1-AP (same clone as 20525-1-PBS)

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 20525-1-AP (AKR1CL2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20525-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 20525-1-AP (same clone as 20525-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 20525-1-AP (AKR1CL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20525-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20525-1-AP (same clone as 20525-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using AKR1CL2 antibody (20525-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 20525-1-PBS in a different storage buffer formulation.

AKR1CL2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 20525-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Aldo-keto reductase family 1 member C-like protein 2, AKRDC1, AKR1E2, AKR1CL 2, AF reductase

---

Product Information

20525-1-PBS targets AKR1CL2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14381

  Product name: Recombinant human AKR1CL2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-307 aa of BC002862

  Sequence: MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM

• Full Name: aldo-keto reductase family 1, member C-like 2
• Calculated Molecular Weight: 320 aa, 37 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC002862
• Gene Symbol: AKR1CL2
• Gene ID (NCBI): 83592
• RRID: AB_10694285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JD6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.