ALAD Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALAD Polyclonal antibody, PBS Only (31686-1-PBS)

• 

  WB analysis using 31686-1-AP (same clone as 31686-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31686-1-AP (ALAD antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31686-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-251 using 31686-1-AP (same clone as 31686-1-PBS)

  WB result of ALAD antibody (31686-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ALAD transfected U-251 cells. This data was developed using the same antibody clone with 31686-1-PBS in a different storage buffer formulation.

ALAD Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31686-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ALADH, Delta aminolevulinic acid dehydratase, Porphobilinogen synthase

---

Product Information

31686-1-PBS targets ALAD in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35649

  Product name: Recombinant human ALAD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-330 aa of NM_000031.5

  Sequence: AEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE

• Full Name: aminolevulinate, delta-, dehydratase
• Calculated Molecular Weight: 36kDa，330aa
• Observed Molecular Weight: 36-39 kDa
• GenBank Accession Number: NM_000031.5
• Gene Symbol: ALAD
• Gene ID (NCBI): 210
• RRID: AB_3670079
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P13716
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Delta-aminolevulinic acid dehydratase (ALAD) is also named as Porphobilinogen synthase. ALAD, encoded by the moonlighting gene ALAD, not only participates in the second step of heme biosynthesis, but also inhibits the 26S proteasome (PMID: 35318110). ALAD is involved in tumor progression. For example, ALAD2 allele (ALAD polymorphism) is related to an increased risk for meningioma, and downregulation of ALAD is related to poor prognosis of patients with breast cancer (PMID: 16140629, PMID: 28403546).