Tested Applications
| Positive WB detected in | A549 cells, HT-29 cells, K-562 cells, HepG2 cells, HuH-7 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15910-1-AP targets ALDH1A1 in WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8665 Product name: Recombinant human ALDH1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 153-501 aa of BC001505 Sequence: TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member A1 |
| Calculated Molecular Weight | 501 aa, 55 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC001505 |
| Gene Symbol | ALDH1A1 |
| Gene ID (NCBI) | 216 |
| RRID | AB_2305276 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00352 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001). This antibody can also recognize some other membranes of the aldehyde dehydrogenase family.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| IF protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| IHC protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| WB protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ALDH1A1 Polyclonal antibody (catalog number 15910-1-AP) has 175 citations. These appear in high-impact journals including Cell Research, Nature Communications, Cancer Research, Cell Death & Disease, Oncogene, EMBO Journal, eLife, and Cell Reports, among others. The associated research fields are dominated by cancer biology, particularly cancer stem cell stemness, epithelial-mesenchymal transition, and chemoresistance across breast, lung, gastric, colorectal, and head-and-neck cancers. Additional studies cover retinoic acid signaling, neurobiology, fibrosis, and developmental biology.
| Species | Application | Title |
|---|---|---|
Cell Res Excessive UBE3A dosage impairs retinoic acid signaling and synaptic plasticity in autism spectrum disorders. | ||
Nat Commun KK-LC-1 as a therapeutic target to eliminate ALDH+ stem cells in triple negative breast cancer | ||
Nat Commun CAV2-expressing nerves induce metabolic switch toward mitochondrial oxidative phosphorylation to promote cancer stemness. | ||
Nat Commun TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling. | ||
Int J Oral Sci LIMP-2 enhances cancer stem-like cell properties by promoting autophagy-induced GSK3β degradation in head and neck squamous cell carcinoma |
Reviews
What customers say
All seven reviews are five-star. Users consistently report strong, specific, and reproducible results. For Western blot, the antibody yields clear, distinct bands at 1:1000 dilution with overnight 4°C incubation across cancer cell lines and mouse mammary epithelial cells. For immunohistochemistry and immunofluorescence, it delivers robust cytoplasmic staining in gut epithelium, adipose tissue, heart, and skeletal muscle at 1:100, working well on both paraffin-embedded and frozen sections with standard antigen retrieval. Reviewers highlight minimal background and reliable performance across multiple replicates and species, recommending it for epithelial biology and retinoic acid signaling studies.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Irshad (Verified Customer) (07-23-2025) | I have used the ALDH1A1 antibody extensively for immunohistochemistry (IHC) on mouse tissue (small and large intestine), and I am very pleased with its performance. The antibody provides robust, specific, and reproducible staining, particularly in epithelial compartments where ALDH1A1 is known to be expressed. The signal intensity is strong with minimal background, and it clearly distinguishes crypt-resident epithelial cells with cytoplasmic localization, consistent with ALDH1A1's enzymatic role in retinoic acid biosynthesis. Tissue preparation and protocol compatibility were straightforward — the antibody worked well with both paraffin-embedded and frozen sections, following standard antigen retrieval (citrate buffer, pH 6.0, microwave treatment). I typically used it at a dilution of 1:100, and it performed consistently across multiple biological replicates. In summary, this antibody has been a reliable tool for visualizing ALDH1A1 expression in gut epithelial cells. I highly recommend it for researchers interested in epithelial biology, vitamin A metabolism, or retinoic acid signaling.
 |
Shinford Z. (Verified Customer) (01-31-2024) | The antibody performs exceptionally well; the band on the membrane is remarkably distinct.
 |
Matthew (Verified Customer) (08-07-2023) | Antibody worked perfectly with overnight incubation at 4C. Diluted 1:1000 in TBST.
|
Udesh (Verified Customer) (02-24-2023) | Worked well at 1:1000 in 5% BSA O/N at 4 degrees
 |
Susmita (Verified Customer) (09-17-2020) | Antibody is working good for WB
|
Mario Armando (Verified Customer) (02-18-2020) | I used this ALDH1A1 antibody on different human and mouse tissues including adipose tissue, heart and skeletal muscle. It worked wonderfully even when using paraffin embedded sections in both human and mouse.
 |
Joleen (Verified Customer) (06-07-2019) | Prominent band correspond to ALDH1A1. Works well in western blot.
 |
