ALDH1A2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86518-1-RR (same clone as 86518-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86518-1-RR (ALDH1A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86518-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 86518-1-RR (same clone as 86518-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using ALDH1A2 antibody (86518-1-RR, Clone: 251371D10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86518-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86518-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86518-1-RR against Human ALDH1A2 were performed. The affinity constant is 0.179 nM.

ALDH1A2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86518-1-PBS

Clone No.251371D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ALDH1A 2, EC:1.2.1.36, RALDH 2, RALDH(II), RalDH2

---

Product Information

86518-1-PBS targets ALDH1A2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5062

  Product name: Recombinant human ALDH1A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-481 aa of BC030589

  Sequence: GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

• Full Name: aldehyde dehydrogenase 1 family, member A2
• Calculated Molecular Weight: 518 aa, 57 kDa
• Observed Molecular Weight: 53-57 kDa
• GenBank Accession Number: BC030589
• Gene Symbol: ALDH1A2
• Gene ID (NCBI): 8854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94788
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ALDH1A2(aldehyde dehydrogenase family 1 member A2) is also named as RALDH2(retinal dehydrogenase 2) and belongs to the aldehyde dehydrogenase family. It is a cytosolic homotetramer(56.7 kDa subunits) exhibiting complex expression patterns throughout embryonic development. ALDH1A2 plays a role in retinoid metabolism during embryonic development where it is considered to be the major retinoic acid-synthesizing enzyme during early embryogenesis(PMID:20735668). Its expression is reduced in primary prostate tumors compared with normal prostate tissue suggested that it is normally expressed in the epithelial compartment of prostate tissue(PMID:16166285).It has 2 isoforms produced by alternative splicing.