CoraLite® Plus 488-conjugated ALDH1B1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated ALDH1B1 Recombinant monoclonal antibody (CL488-85426-2)

• 

  IF Staining of HepG2 using CL488-85426-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 ALDH1B1 antibody (CL488-85426-2, Clone: 242944E7 ) at dilution of 1:200, CL594-phalloidin (red).

ALDH1B1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85426-2

Clone No.242944E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Aldehyde dehydrogenase 5, Aldehyde dehydrogenase X, mitochondrial, ALDH5, ALDHX, EC:1.2.1.3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85426-2 targets ALDH1B1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7144

  Product name: Recombinant human ALDH1B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 168-517 aa of BC001619

  Sequence: FCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS

• Full Name: aldehyde dehydrogenase 1 family, member B1
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC001619
• Gene Symbol: ALDH1B1
• Gene ID (NCBI): 219
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30837
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112).