ALDH1L1 Polyclonal antibody, PBS Only

• 

  WB analysis using 17390-1-AP (same clone as 17390-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 17390-1-AP (ALDH1L1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 17390-1-AP (same clone as 17390-1-PBS)

  IP result of anti-ALDH1L1 (IP:17390-1-AP, 4ug; Detection:17390-1-AP 1:500) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 17390-1-AP (same clone as 17390-1-PBS)

  IP result of anti-ALDH1L1 (IP:17390-1-AP, 4ug; Detection:17390-1-AP 1:500) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 17390-1-AP (same clone as 17390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 17390-1-AP (ALDH1L1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 17390-1-AP (same clone as 17390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 17390-1-AP (ALDH1L1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17390-1-AP (same clone as 17390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17390-1-AP (ALDH1L1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 17390-1-AP (same clone as 17390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 17390-1-AP (ALDH1L1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 17390-1-AP (same clone as 17390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 17390-1-AP (ALDH1L1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17390-1-AP (same clone as 17390-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17390-1-AP (ALDH1L1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 17390-1-AP (same clone as 17390-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using ALDH1L1 antibody (17390-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 17390-1-AP (same clone as 17390-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using ALDH1L1 antibody (17390-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17390-1-PBS in a different storage buffer formulation.

ALDH1L1 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Cat No. 17390-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Synonyms

10 FTHFDH, 10-FTHFDH, ALDH1L 1, Cytosolic 10-formyltetrahydrofolate dehydrogenase, EC:1.5.1.6

---

Product Information

17390-1-PBS targets ALDH1L1 in WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11285

  Product name: Recombinant human ALDH1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 157-505 aa of BC027241

  Sequence: DDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMYRAPPSPSTRPDPTAT

• Full Name: aldehyde dehydrogenase 1 family, member L1
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC027241
• Gene Symbol: ALDH1L1
• Gene ID (NCBI): 10840
• RRID: AB_2878401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75891
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aldehyde dehydrogenase 1 family member L1 (ALDH1L1), belongs to the aldehyde dehydrogenase family of proteins and is responsible for formate oxidation in vivo. Loss of ALDH1L1 is associated with decreased apoptosis, increased cell motility, and cancer progression. ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 has some isoforms with MW of 99, 88 and 55 kDa.