ALDH1L2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALDH1L2 Polyclonal antibody, PBS Only (21391-1-PBS)

• 

  WB analysis using 21391-1-AP (same clone as 21391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21391-1-AP (ALDH1L2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21391-1-AP (same clone as 21391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21391-1-AP (ALDH1L2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 21391-1-AP (same clone as 21391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 21391-1-AP (ALDH1L2 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 21391-1-AP (same clone as 21391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 21391-1-AP (ALDH1L2 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 21391-1-AP (same clone as 21391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart slide using 21391-1-AP (ALDH1L2 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 21391-1-AP (same clone as 21391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart slide using 21391-1-AP (ALDH1L2 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 21391-1-AP (same clone as 21391-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ALDH1L2 antibody (21391-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21391-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ALDH1L2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21391-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21391-1-PBS targets ALDH1L2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16046

  Product name: Recombinant human ALDH1L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC103935

  Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS

• Full Name: aldehyde dehydrogenase 1 family, member L2
• Calculated Molecular Weight: 923 aa, 102 kDa
• Observed Molecular Weight: 102 kDa, 89 kDa
• GenBank Accession Number: BC103935
• Gene Symbol: ALDH1L2
• Gene ID (NCBI): 160428
• RRID: AB_2878854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SY69
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ALDH1L2(Aldehyde dehydrogenase family 1 member L2) is also named as mitochondrial 10-FTHFDH, mtFDH and belongs to the aldehyde dehydrogenase family and ALDH1L subfamily. The ALDH1L2 gene has three transcriptional variants with the molecular weight of 102 kDa, 42 kDa and 89 kDa(PMID:19823103). It is a mitochondrial enzyme, a likely source of CO2 production from 10-formyltetrahydrofolate in mitochondria and playing an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell(PMID: 20498374). It also has dehydrogenase/hydrolase activities similar to cytosolic FDH (ALDH1L1). The native ALDH1L2 has been reported to exist as a dimer or tetramer(PMID:7822273).