ALDH3B1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALDH3B1 Polyclonal antibody (19446-1-AP)

• Featured Product
• KD/KO Validated

ALDH3B1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19446-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Aldehyde dehydrogenase 7, ALDH4, ALDH7, EC:1.2.1.28

• 

  WB analysis of RAW 264.7 using 19446-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 19446-1-AP (ALDH3B1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 19446-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19446-1-AP (ALDH3B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 19446-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 19446-1-AP (ALDH3B1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 19446-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 19446-1-AP (ALDH3B1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 19446-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 19446-1-AP (ALDH3B1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 19446-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 19446-1-AP (ALDH3B1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, J774A.1 cells, rat liver tissue
• Positive IHC detected in: human lung cancer tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19446-1-AP targets ALDH3B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7025

  Product name: Recombinant human ALDH3B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-230 aa of BC002553

  Sequence: MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHPSKQRLPPPSWVFPLPASASSLSRSQP

• Full Name: aldehyde dehydrogenase 3 family, member B1
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002553
• Gene Symbol: ALDH3B1
• Gene ID (NCBI): 221
• RRID: AB_2861362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43353
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALDH3B1(Aldehyde dehydrogenase family 3 member B1) is also named as ALDH7 and belongs to the aldehyde dehydrogenase family. It catalyzes fatty and aromatic aldehydes. ALDH3B1 may play a role in the detoxification of aldehydes produced during oxidative stress. This protein has 2 isoforms produced by alternative splicing.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Elife; FAK activity sustains intrinsic and acquired ovarian cancer resistance to platinum chemotherapy.; Authors - Carlos J Diaz Osterman
human	IHC	Cell Death Dis; Aldehyde dehydrogenase 3B2 promotes the proliferation and invasion of cholangiocarcinoma by increasing Integrin Beta 1 expression; Authors - Yue Wang
human	WB	Front Immunol; The ALDH Family Contributes to Immunocyte Infiltration, Proliferation and Epithelial-Mesenchymal Transformation in Glioma.; Authors - Zeyu Wang ; KD Validated
mouse	WB	Cell Stress Chaperones; ALDH3B1 protects interfollicular epidermal cells against lipid peroxidation via the NRF2 pathway; Authors - Zhenjie Wu