ALG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALG3 Polyclonal antibody, PBS Only (28084-1-PBS)

• 

  WB analysis of HeLa using 28084-1-AP (same clone as 28084-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 28084-1-AP (ALG3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 28084-1-AP (same clone as 28084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 28084-1-AP (same clone as 28084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 28084-1-AP (ALG3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28084-1-PBS in a different storage buffer formulation.

ALG3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28084-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28084-1-PBS targets ALG3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26382

  Product name: Recombinant human ALG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC002839

  Sequence: MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCC

• Full Name: asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S. cerevisiae)
• Calculated Molecular Weight: 438 aa, 50 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC002839
• Gene Symbol: ALG3
• Gene ID (NCBI): 10195
• RRID: AB_3669644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92685
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha-1,3-mannosyltransferase (ALG3) encodes an endoplasmic reticulum-localized ALG3 family member that participates in N-glycan synthesis. ALG3 contributes to high mannose-type N-glycans in several cancers, and mannose-type N-glycan upregulation has been shown to be related to cancer progression. ALG3 is overexpressed in oral squamous cell carcinoma(PMID: 33084111), non-small cell lung cancer(PMID: 31899049), and breast cancer(PMID: 33931075) and hepatocellular carcinoma(PMID: 35782861).