ALOX15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALOX15 Polyclonal antibody, PBS Only (13286-1-PBS)

• 

  WB analysis using 13286-1-AP (same clone as 13286-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13286-1-AP (ALOX15 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13286-1-PBS in a different storage buffer formulation.

ALOX15 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13286-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

15LOX, 15 LOX2, 15 LOX 1, 15 LOX, 12-LOX

---

Product Information

13286-1-PBS targets ALOX15 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4040

  Product name: Recombinant human ALOX15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC029032

  Sequence: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQ

• Full Name: arachidonate 15-lipoxygenase
• Calculated Molecular Weight: 662 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC029032
• Gene Symbol: ALOX15
• Gene ID (NCBI): 246
• RRID: AB_3669158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16050
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.