ALPI Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALPI Polyclonal antibody (33485-1-AP)

• 

  WB analysis using 33485-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33485-1-AP (ALPI antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33485-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33485-1-AP (ALPI antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

ALPI Polyclonal Antibody for WB, ELISA

Cat No. 33485-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:3.1.3.1, IAP, Intestinal alkaline phosphatase, Intestinal-type alkaline phosphatase

---

Tested Applications

• Positive WB detected in: rat kidney tissue, mouse kidney tissue, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33485-1-AP targets ALPI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36025

  Product name: Recombinant human ALPI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-220 aa of BC132678

  Sequence: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILG

• Full Name: alkaline phosphatase, intestinal
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC132678
• Gene Symbol: ALPI
• Gene ID (NCBI): 248
• RRID: AB_3742989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P09923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALPI (intestinal alkaline phosphatase) is a brush-border enzyme expressed in the gut that plays a critical role in maintaining intestinal homeostasis. By dephosphorylating pro-inflammatory microbial products, it helps prevent bacterial translocation and systemic inflammation. Dysfunction or deficiency of ALPI is linked to conditions such as increased intestinal permeability, metabolic disorders, and inflammatory diseases, making it a promising therapeutic target for preserving gut health.