Use Able AI chat for product recommendations

AMPD2 Monoclonal antibody

AMPD2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67430-1-Ig
Clone No. 2C4C1
Publications (2)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

AMP deaminase 2, AMP deaminase isoform L, AMPD2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AMPD2 in ?

Tested Applications

Positive WB detected inHSC-T6 cells, 4T1 cells, HeLa cells, HepG2 cells, L02 cells, Neuro-2a cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:3000-1:20000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67430-1-Ig targets AMPD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivitymouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8433

Product name: Recombinant human AMPD2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 448-798 aa of BC007711

Sequence: LEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ

Predict reactive species
Full Name adenosine monophosphate deaminase 2 (isoform L)
Calculated Molecular Weight879aa,101 kDa; 798aa,92 kDa
Observed Molecular Weight 101 kDa
GenBank Accession NumberBC007711
Gene Symbol AMPD2
Gene ID (NCBI) 271
RRIDAB_2882668
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ01433
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Adenosine monophosphate deaminase (AMPD) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. Three AMPDs are present in mammals named AMPD1/2/3. AMPD2 is the main activity present in adult human liver and is widely expressed in non-muscle tissues and cells (PMID: 8526848). AMPD2 has some isoforms with the molecular mass of 88-101 kDa.

Protocols

Product Specific Protocols
IF protocol for AMPD2 antibody 67430-1-IgDownload protocol
IHC protocol for AMPD2 antibody 67430-1-IgDownload protocol
WB protocol for AMPD2 antibody 67430-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The AMPD2 Monoclonal antibody (2C4C1), catalog number 67430-1-Ig, has a total of 2 citations published in Cell Host Microbe and Pharmaceuticals (Basel). The research fields covered include liver-gut endocrine axis and microbiome-mediated lipid metabolism, as well as podocyte mitochondrial energy metabolism and glomerular injury. Both studies applied the antibody via Western blot using mouse and rat samples.

SpeciesApplicationTitle
mouseWB

Cell Host Microbe

Uric acid promotes dietary lipid absorption through microbiome and metabolomic remodeling via a liver-gut endocrine axis.

Authors - Cheng Tian
  • KO Validated
mouse, ratWB

Pharmaceuticals (Basel)

Morin Alleviates Fructose-Driven Disturbance of Podocyte Mitochondrial Energy Metabolism by Inhibiting Adenosine 5'-Monophosphate Deaminase Activity to Improve Glomerular Injury.

Authors - Yingzhi Yang
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...