Home
Products
Primary Antibodies
AMPK Alpha 2 Polyclonal antibody, PBS Only (18167-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis of HEK-293 using 18167-1-AP (same clone as 18167-1-PBS)
WB result of AMPK alpha 2 antibody (18167-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-AMPK alpha 2 transfected HEK-293 cells. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
WB analysis using 18167-1-AP (same clone as 18167-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
WB analysis of rat ovary using 18167-1-AP (same clone as 18167-1-PBS)
rat ovary tissue were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 18167-1-AP (same clone as 18167-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
WB analysis of human skeletal muscle using 18167-1-AP (same clone as 18167-1-PBS)
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
WB analysis using 18167-1-AP (same clone as 18167-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 18167-1-AP (same clone as 18167-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
IP experiment of mouse skeletal muscle using 18167-1-AP (same clone as 18167-1-PBS)
IP result of anti-AMPK Alpha 2 (IP:18167-1-AP, 4ug; Detection:18167-1-AP 1:1000) with mouse skeletal muscle tissue lysate 3600ug. This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18167-1-AP (same clone as 18167-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18167-1-AP (same clone as 18167-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 18167-1-AP (same clone as 18167-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 18167-1-AP (same clone as 18167-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.
IF Staining of MCF-7 using 18167-1-AP (same clone as 18167-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using AMPK Alpha 2 antibody (18167-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18167-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

AMPK Alpha 2 Polyclonal antibody, PBS Only

Name: AMPK Alpha 2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 18167-1-PBS

AMPK Alpha 2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18167-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

PRKAA2, 5'-AMP-activated protein kinase catalytic subunit alpha-2, ACACA kinase, Acetyl-CoA carboxylase kinase, AMPK

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

18167-1-PBS targets AMPK Alpha 2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12796 Product name: Recombinant human PRKAA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 215-552 aa of BC069680 Sequence: DDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR Predict reactive species
Full Name	protein kinase, AMP-activated, alpha 2 catalytic subunit
Calculated Molecular Weight	552 aa, 62 kDa
Observed Molecular Weight	62 kDa
GenBank Accession Number	BC069680
Gene Symbol	AMPK Alpha 2
Gene ID (NCBI)	5563
RRID	AB_10695046
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P54646
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PRKAA2(protein kinase, AMP-activated, alpha 2 catalytic subunit), also named as AMPKA2, AMPK, PRKAA, AMPK2, belongs to the CAMK Ser/Thr protein kinase family and SNF1 subfamily. PRKAA2 is an αβγ heterotrimer that is activated by low cellular energy status, such as decreases in both the ATP/AMP ratio and the phosphocreatine content and it is a glycogen synthase kinase, phosphorylating Ser7 at the NH2 terminus, which decreases glycogen synthase activity (PMID:14532170). The protein can be ubiquitinated (PMID:21224036).