AMPK Alpha Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80209-5-RR (same clone as 80209-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80209-5-RR (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80209-5-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 80209-5-RR (same clone as 80209-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using AMPK Alpha antibody (80209-5-RR, Clone: 4N5 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80209-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80209-5-RR

  Biolayer interferometry (BLl) kinetic assays of 80209-5-RR against Human AMPK alpha were performed. The affinity constant is below 1 pM.

AMPK Alpha Uni-rAb^® Recombinant Antibody for WB, IF-P, Indirect ELISA

Cat No. 80209-5-PBS

Clone No.4N5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

AMPK Alpha 1, PRKAA1, AMPK, Acetyl-CoA carboxylase kinase, ACACA kinase

---

Product Information

80209-5-PBS targets AMPK Alpha in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1367

  Product name: Recombinant human AMPK alpha protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-207 aa of BC012622

  Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

• Full Name: protein kinase, AMP-activated, alpha 1 catalytic subunit
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC012622
• Gene Symbol: AMPK Alpha 1
• Gene ID (NCBI): 5562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13131
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing. 80209-5-RR can recognize both AMPK Alpha 1 and AMPK Alpha 2.