AMPK Alpha Recombinant monoclonal antibody, PBS Only

AMPK Alpha Uni-rAb® Recombinant Antibody for WB, IF-P, Indirect ELISA
Cat No. 80209-5-PBS
Clone No.4N5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

AMPK Alpha 1, PRKAA1, AMPK, Acetyl-CoA carboxylase kinase, ACACA kinase

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80209-5-PBS targets AMPK Alpha in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1367

Product name: Recombinant human AMPK alpha protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC012622

Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

Predict reactive species
Full Name protein kinase, AMP-activated, alpha 1 catalytic subunit
Calculated Molecular Weight 63 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC012622
Gene Symbol AMPK Alpha 1
Gene ID (NCBI) 5562
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13131
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing. 80209-5-RR can recognize both AMPK Alpha 1 and AMPK Alpha 2.

Loading...
||
New chat Able
正在加载,请稍候...