AMPK Alpha Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AMPK Alpha Recombinant monoclonal antibody (80209-5-RR)

AMPK Alpha Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 80209-5-RR Copied!

Clone No. 4N5

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF-P, ELISA

Synonyms

AMPK Alpha 1, PRKAA1, 4N5, 5'-AMP-activated protein kinase catalytic subunit alpha-1, AAPK1

• 

  WB analysis using 80209-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80209-5-RR (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat brain using 80209-5-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using AMPK Alpha antibody (80209-5-RR, Clone: 4N5 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 80209-5-RR

  Biolayer interferometry (BLl) kinetic assays of 80209-5-RR against Human AMPK alpha were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AMPK Alpha in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IF-P detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80209-5-RR targets AMPK Alpha in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1367

  Product name: Recombinant human AMPK alpha protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-207 aa of BC012622

  Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

• Full Name: protein kinase, AMP-activated, alpha 1 catalytic subunit
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC012622
• Gene Symbol: AMPK Alpha 1
• Gene ID (NCBI): 5562
• RRID: AB_3670471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13131
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing. 80209-5-RR can recognize both AMPK Alpha 1 and AMPK Alpha 2.

Publications

What published studies show

AMPK Alpha Recombinant monoclonal antibody (4N5), catalog number 80209-5-RR, has 6 total citations. These appear in journals including Autophagy, Advanced Healthcare Materials, Antioxidants, Life Sciences, Animal Models and Experimental Medicine, and Biomedical Chromatography. The research fields span autophagy and lipid metabolism in age-related macular degeneration, obesity and adipose tissue browning, oxidative stress, mitochondrial function in prion disease, urinary incontinence via AMPK activation, and non-alcoholic fatty liver disease.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; FASN mediates crosstalk between autophagy and lipid metabolism via the AMPK-MTOR pathway in early age-related macular degeneration.; Authors - Jinyu Cai
mouse	WB	Adv Healthc Mater; Near-Infrared-II Photothermal Agents Targeting Lipid Droplets to Ameliorate Obesity Through Induction of Adipose Tissue Browning.; Authors - Shaofan Wang
bovine	WB,IF	Antioxidants (Basel); Development of an AAPH-Induced Oxidative Stress Model in Bovine Mammary Epithelial Cells and Investigation of Its Molecular Mechanisms.; Authors - Yuanyuan Zhang
mouse	WB	Life Sci; Idebenone improves mitochondrial respiratory activity and attenuates oxidative damage via the SIRT3-SOD2 pathway in a prion disease cell model; Authors - Zhixin Sun
rat	WB	Animal Model Exp Med; Metformin enhances external urethral sphincter integrity and restores continence via AMPK activation in a rat model of stress urinary incontinence.; Authors - Yuting Xu
mouse	WB	Biomed Chromatogr; Untargeted Metabolomic Analysis Reveals the Mechanism Underlying Swertia mussotii Treatment on Rats With Non-Alcoholic Fatty Liver Disease Using UPLC-Q-TOF/MS.; Authors - Minyue Zhang