AMT Monoclonal antibody

• 

  WB analysis of pig liver using 67532-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67532-1-Ig (AMT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 67532-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67532-1-Ig (AMT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 67532-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67532-1-Ig (AMT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67532-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67532-1-Ig (AMT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67532-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67532-1-Ig (AMT antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67532-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using AMT antibody (67532-1-Ig, Clone: 3E7D4 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

• 

  Affinity and Kinetic Characterization of 67532-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 67532-1-Ig against Human AMT was performed. The affinity constant is 8.85 nM.

AMT Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67532-1-Ig

Clone No.3E7D4

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GCST, 3E7D4, aminomethyltransferase, EC:2.1.2.10, GCVT

---

Tested Applications

• Positive WB detected in: pig liver tissue, rat liver tissue, mouse liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67532-1-Ig targets AMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26644

  Product name: Recombinant human AMT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 147-321 aa of BC007546

  Sequence: EKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLM

• Full Name: aminomethyltransferase
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 37-44 kDa
• GenBank Accession Number: BC007546
• Gene Symbol: AMT
• Gene ID (NCBI): 275
• RRID: AB_2882751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P48728
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; Multiomic landscape of immune pathogenesis in Kimura's disease; Authors - Xunyao Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (06-17-2021)

Good antibody and the background is clean on WB.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse liver and brain

AMT Antibody Western Blot validation (1:1000 dilution) in Mouse liver and brain (Cat no:67532-1-Ig)