Tested Applications
| Positive WB detected in | mouse pancreas tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12540-1-AP targets Amylase Alpha in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3260 Product name: Recombinant human AMY2B protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 160-511 aa of BC011179 Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species |
| Full Name | amylase, alpha 2B (pancreatic) |
| Calculated Molecular Weight | 511 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC011179 |
| Gene Symbol | AMY2B |
| Gene ID (NCBI) | 280 |
| RRID | AB_2273990 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19961 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. The full length 58 kDa protein has a signal peptide with 15 amino acids. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). 12540-1-AP can recognize both AMY2A and AMY2B.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| IHC protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| WB protocol for Amylase Alpha antibody 12540-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Amylase Alpha Polyclonal antibody (Cat# 12540-1-AP) has 26 citations. These appear in journals including Cell, ACS Nano, Acta Biomater, Cancer Lett, FASEB J, Int Immunopharmacol, Brain Behav Immun, Am J Pathol, and others. Research fields span acute pancreatitis treatment, pancreatic cancer progression, salivary gland regeneration, nanomedicine, inflammation, circadian rhythm disruption, and fibrosis.
| Species | Application | Title |
|---|---|---|
Adv Mater Engineered Stem Cell Booster Breaks Pathological Barriers to Treat Chronic Pancreatitis | ||
ACS Nano Inflammation and Acinar Cell Dual-Targeting Nanomedicines for Synergistic Treatment of Acute Pancreatitis via Ca2+ Homeostasis Regulation and Pancreas Autodigestion Inhibition | ||
ACS Nano Biomimetic Trypsin-Responsive Structure-Bridged Mesoporous Organosilica Nanomedicine for Precise Treatment of Acute Pancreatitis | ||
Cancer Lett SULF2 enhances GDF15-SMAD axis to facilitate the initiation and progression of pancreatic cancer. | ||
Acta Biomater Injectable decellularized extracellular matrix hydrogel promotes salivary gland regeneration via endogenous stem cell recruitment and suppression of fibrogenesis |
Reviews
What customers say
All 7 reviews are 5-star ratings. Users consistently report excellent performance in Western Blot, IHC, and IF applications. The antibody is described as easy to work with and reliable across a wide range of dilutions (1:1000–1:20000). It has been validated on intestinal tissue, colon cancer cell lines, HEK293T cells overexpressing AMY2A, and pancreatic cancer cells/tissue. Reviewers highlight clear specific signals with minimal background and overall high satisfaction with the product's quality and consistency.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (01-08-2026) | Amylase antibody worked very good.
|
Mounika (Verified Customer) (01-08-2026) | Wonderful antibodies , easy to work with !
|
Mounika (Verified Customer) (01-08-2026) | Best and easy to work with, No Hassale!
|
Gabriele (Verified Customer) (07-18-2025) | The antibody works very well both in WB (1:5000, 5% milk) and IF (1:200, 5% BSA) on HEK293T over-expressing human AMY2A 48h post-transfection vs not-treated control
 |
balawant (Verified Customer) (08-06-2022) | This antibody is working great and need 1:20000 dilution.
|
Susmita (Verified Customer) (06-13-2022) | This is an excellent antibody for IHC and WB application
|
Iram (Verified Customer) (03-11-2022) | Very good antibody for western
|
