Amylase Alpha Polyclonal antibody

Amylase Alpha Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 12540-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

AMY2B, Amylase, alpha, 1,4-alpha-D-glucan glucanohydrolase 2B, Alpha amylase, Alpha amylase 2B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse pancreas tissue
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat pancreas tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12540-1-AP targets Amylase Alpha in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3260

Product name: Recombinant human AMY2B protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 160-511 aa of BC011179

Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Predict reactive species
Full Name amylase, alpha 2B (pancreatic)
Calculated Molecular Weight 511 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC011179
Gene Symbol AMY2B
Gene ID (NCBI) 280
RRIDAB_2273990
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19961
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. The full length 58 kDa protein has a signal peptide with 15 amino acids. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). 12540-1-AP can recognize both AMY2A and AMY2B.

Protocols

Product Specific Protocols
IF protocol for Amylase Alpha antibody 12540-1-APDownload protocol
IHC protocol for Amylase Alpha antibody 12540-1-APDownload protocol
WB protocol for Amylase Alpha antibody 12540-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

ACS Nano

Inflammation and Acinar Cell Dual-Targeting Nanomedicines for Synergistic Treatment of Acute Pancreatitis via Ca2+ Homeostasis Regulation and Pancreas Autodigestion Inhibition

Authors - Yanan Wang
mouseIF

Cancer Lett

SULF2 enhances GDF15-SMAD axis to facilitate the initiation and progression of pancreatic cancer.

Authors - Ruizhe He

Biochim Biophys Acta Mol Basis Dis

Pyrazole derivative Z10 ameliorates acute pancreatitis by inhibiting the ERK/Ddt pathway

Authors - Wenying Zeng
mouseWB,IHC

Int Immunopharmacol

Gastrodin ameliorates acute pancreatitis by modulating macrophage inflammation cascade via inhibition the p38/NF-κB pathway

Authors - Yalan Jiang
mouseIHC

Mol Biol Cell

Vacuolization of mucolipidosis type II mouse exocrine gland cells represents accumulation of autolysosomes.

Authors - Boonen Marielle M
mouseIF

Biomed Pharmacother

Serotonin-RhoA/ROCK axis promotes acinar-to-ductal metaplasia in caerulein-induced chronic pancreatitis.

Authors - Xufeng Tao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Gabriele (Verified Customer) (07-18-2025)

The antibody works very well both in WB (1:5000, 5% milk) and IF (1:200, 5% BSA) on HEK293T over-expressing human AMY2A 48h post-transfection vs not-treated control

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: WB: 1:5000 - IF: 1:200
  • Cell Tissue Type: HEK293T
Amylase Alpha Antibody Western Blot,Immunofluorescence validation (WB: 1:5000 - IF: 1:200 dilution) in HEK293T (Cat no:12540-1-AP)
FH

balawant (Verified Customer) (08-06-2022)

This antibody is working great and need 1:20000 dilution.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:20000
  • Cell Tissue Type: Intestinal tissue and colon cancer cell line
FH

Susmita (Verified Customer) (06-13-2022)

This is an excellent antibody for IHC and WB application

  • Applications: Western Blot
  • Primary Antibody Dilution: WB: 1: 4000, IHC 1: 400
  • Cell Tissue Type: PC cell line PC tissue
FH

Iram (Verified Customer) (03-11-2022)

Very good antibody for western

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Colon cancer cells
Loading...
||
New chat Able
正在加载,请稍候...