CoraLite® Plus 488-conjugated ANAPC10 Recombinant monoclonal antibody

ANAPC10 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83570-4
Clone No.240492E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240492E7, ANAPC 10, Anaphase-promoting complex subunit 10, APC10, DOC1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83570-4 targets ANAPC10 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8487

Product name: Recombinant human ANAPC10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-185 aa of BC005217

Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Predict reactive species
Full Name anaphase promoting complex subunit 10
Calculated Molecular Weight 185 aa, 21 kDa
GenBank Accession NumberBC005217
Gene Symbol ANAPC10
Gene ID (NCBI) 10393
RRIDAB_3673273
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UM13
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The anaphase promoting complex/cyclosome (APC/C) is a cell cycle-regulated multimeric E3 ubiquitin ligase assembled from 13 individual subunits. The anaphase promoting complex subunit 10 (APC10) is a core subunit of APC/C that is highly conserved in humans. APC10 genetically and physically interacts with a series of subunits of the APC/C and is necessary for the ubiquitination activity of APC/C by enhancing the affinity of the APC/C for its substrate.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ANAPC10 antibody CL488-83570-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...