CoraLite® Plus 488-conjugated ANAPC10 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-83570-4

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 ANAPC10 antibody (CL488-83570-4, Clone: 240492E7 ) at dilution of 1:200.

ANAPC10 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83570-4

Clone No.240492E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

240492E7, ANAPC 10, Anaphase-promoting complex subunit 10, APC10, DOC1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83570-4 targets ANAPC10 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8487

  Product name: Recombinant human ANAPC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC005217

  Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

• Full Name: anaphase promoting complex subunit 10
• Calculated Molecular Weight: 185 aa, 21 kDa
• GenBank Accession Number: BC005217
• Gene Symbol: ANAPC10
• Gene ID (NCBI): 10393
• RRID: AB_3673273
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UM13
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The anaphase promoting complex/cyclosome (APC/C) is a cell cycle-regulated multimeric E3 ubiquitin ligase assembled from 13 individual subunits. The anaphase promoting complex subunit 10 (APC10) is a core subunit of APC/C that is highly conserved in humans. APC10 genetically and physically interacts with a series of subunits of the APC/C and is necessary for the ubiquitination activity of APC/C by enhancing the affinity of the APC/C for its substrate.