ANAPC5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67348-1-Ig (same clone as 67348-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67348-1-Ig (ANAPC5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67348-1-Ig (same clone as 67348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67348-1-Ig (ANAPC5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67348-1-Ig (same clone as 67348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67348-1-Ig (ANAPC5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67348-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 67348-1-Ig (same clone as 67348-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using ANAPC5 antibody (67348-1-Ig, Clone: 2A7G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67348-1-PBS in a different storage buffer formulation.

ANAPC5 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67348-1-PBS

Clone No.2A7G5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

ANAPC5, APC5, Cyclosome subunit 5

---

Product Information

67348-1-PBS targets ANAPC5 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7409

  Product name: Recombinant human ANAPC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC001081

  Sequence: MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHC

• Full Name: anaphase promoting complex subunit 5
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85 kDa, 72 kDa
• GenBank Accession Number: BC001081
• Gene Symbol: ANAPC5
• Gene ID (NCBI): 51433
• RRID: AB_2882606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UJX4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.