Angiopoietin 1 Recombinant monoclonal antibody, PBS Only

Angiopoietin 1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 81990-4-PBS
Clone No.240764D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

ANGPT1, 240764D10, AGP1, AGPT, ANG 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81990-4-PBS targets Angiopoietin 1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18829

Product name: Recombinant human ANGPT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 161-293 aa of BC152411

Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG

Predict reactive species
Full Name angiopoietin 1
Calculated Molecular Weight 498 aa, 58 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC152411
Gene Symbol Angiopoietin 1
Gene ID (NCBI) 284
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ15389
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.

Loading...
||
New chat Able
正在加载,请稍候...