Filter: AllWBIHCIF-PFC (Intra)Affinity

WB analysis using 81990-4-RR (same clone as 81990-4-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
WB analysis using 81990-4-RR (same clone as 81990-4-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 81990-4-RR (same clone as 81990-4-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 81990-4-RR (same clone as 81990-4-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 81990-4-RR (same clone as 81990-4-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 81990-4-RR (same clone as 81990-4-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
IF Staining of human lung using 81990-4-RR (same clone as 81990-4-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
IF Staining of human lung using 81990-4-RR (same clone as 81990-4-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
FC experiment of HepG2 using 81990-4-RR (same clone as 81990-4-PBS)
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Angiopoietin 1 Recombinant antibody (81990-4-RR, Clone:240764D10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
×
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Angiopoietin 1 Recombinant antibody (81990-4-RR, Clone:240764D10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
FC experiment of A431 using 81990-4-RR (same clone as 81990-4-PBS)
1x10^6 A431 cells were intracellularly stained with 0.25 ug Angiopoietin 1 Recombinant antibody (81990-4-RR, Clone:240764D10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
×
1x10^6 A431 cells were intracellularly stained with 0.25 ug Angiopoietin 1 Recombinant antibody (81990-4-RR, Clone:240764D10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 81990-4-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 81990-4-RR
Biolayer interferometry (BLl) kinetic assays of 81990-4-RR against Human ANGPT1 were performed. The affinity constant is 6.37 nM.

Angiopoietin 1 Recombinant monoclonal antibody, PBS Only

Angiopoietin 1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 81990-4-PBS

Clone No.240764D10

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

ANGPT1, 240764D10, AGP1, AGPT, ANG 1

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

81990-4-PBS targets Angiopoietin 1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag18829 Product name: Recombinant human ANGPT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 161-293 aa of BC152411 Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG Predict reactive species
Full Name	angiopoietin 1
Calculated Molecular Weight	498 aa, 58 kDa
Observed Molecular Weight	70 kDa
GenBank Accession Number	BC152411
Gene Symbol	Angiopoietin 1
Gene ID (NCBI)	284
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	Q15389
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.