Angiopoietin 1 Recombinant monoclonal antibody

• 

  WB analysis using 81990-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 81990-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 81990-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 81990-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 81990-4-RR (Angiopoietin 1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse colon using 81990-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse colon using 81990-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human lung using 81990-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human lung using 81990-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Angiopoietin 1 antibody (81990-4-RR, Clone: 240764D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HepG2 using 81990-4-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Angiopoietin 1 Recombinant antibody (81990-4-RR, Clone:240764D10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of A431 using 81990-4-RR

  1x10^6 A431 cells were intracellularly stained with 0.25 ug Angiopoietin 1 Recombinant antibody (81990-4-RR, Clone:240764D10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 81990-4-RR

  Biolayer interferometry (BLl) kinetic assays of 81990-4-RR against Human ANGPT1 were performed. The affinity constant is 6.37 nM.

Angiopoietin 1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 81990-4-RR

Clone No.240764D10

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

ANGPT1, 240764D10, AGP1, AGPT, ANG 1

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, U-87 MG cells, K-562 cells, Raji cells
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse colon tissue, human lung tissue
• Positive FC (Intra) detected in: HepG2 cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81990-4-RR targets Angiopoietin 1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18829

  Product name: Recombinant human ANGPT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 161-293 aa of BC152411

  Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG

• Full Name: angiopoietin 1
• Calculated Molecular Weight: 498 aa, 58 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC152411
• Gene Symbol: Angiopoietin 1
• Gene ID (NCBI): 284
• RRID: AB_3670511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q15389
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Angie (Verified Customer) (07-25-2025)

The antibody detected 3 bands around 55 kD, 75 kDa and 125 kDa at dilution of 1:4000 incubated at room temperature for 2 hours followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated 1 hour at room temperature.

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: A549

Angiopoietin 1 Antibody Western Blot validation (1:4000 dilution) in A549 (Cat no:81990-4-RR)

FH

Marine (Verified Customer) (07-01-2025)

It works well, it is specific with ANG1

• Applications: Western Blot
• Primary Antibody Dilution: 1/500 and 1/1000
• Cell Tissue Type: Tumoral cells, endothelial cells, mouse fibroblasts

Angiopoietin 1 Antibody Western Blot validation (1/500 and 1/1000 dilution) in Tumoral cells, endothelial cells, mouse fibroblasts (Cat no:81990-4-RR)