Use Able AI chat for product recommendations

Angiopoietin 1 Recombinant monoclonal antibody

Angiopoietin 1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 81990-4-RR
Clone No.240764D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

ANGPT1, 240764D10, AGP1, AGPT, ANG 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, U-87 MG cells, K-562 cells, Raji cells
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, human lung tissue
Positive FC (Intra) detected inHepG2 cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81990-4-RR targets Angiopoietin 1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18829

Product name: Recombinant human ANGPT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 161-293 aa of BC152411

Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG

Predict reactive species
Full Name angiopoietin 1
Calculated Molecular Weight 498 aa, 58 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC152411
Gene Symbol Angiopoietin 1
Gene ID (NCBI) 284
RRIDAB_3670511
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ15389
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.

Protocols

Product Specific Protocols
FC protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
IF protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
IHC protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
WB protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Br J Pharmacol

The selective degradation of PDE4B shortform, using a PROTAC, leads to inhibition of several hallmarks of cancer in HCT116 cells.

Authors - Alina Zorn

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Angie (Verified Customer) (07-25-2025)

The antibody detected 3 bands around 55 kD, 75 kDa and 125 kDa at dilution of 1:4000 incubated at room temperature for 2 hours followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated 1 hour at room temperature.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: A549
Angiopoietin 1 Antibody Western Blot validation (1:4000 dilution) in A549 (Cat no:81990-4-RR)

Marine (Verified Customer) (07-01-2025)

It works well, it is specific with ANG1

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/500 and 1/1000
  • Cell Tissue Type: Tumoral cells, endothelial cells, mouse fibroblasts
Angiopoietin 1 Antibody Western Blot validation (1/500 and 1/1000 dilution) in Tumoral cells, endothelial cells, mouse fibroblasts (Cat no:81990-4-RR)
Loading...
||
New chat

Able

正在加载,请稍候...