ANGPTL4 Monoclonal antibody, PBS Only

ANGPTL4 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67577-1-PBS
Clone No.1D2H6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Angiopoietin-related protein 4, Angiopoietin-like protein 4, Angiopoietin related protein 4, Angiopoietin like protein 4, angiopoietin like 4

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67577-1-PBS targets ANGPTL4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30070

Product name: Recombinant human ANGPTL4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC023647

Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL

Predict reactive species
Full Name angiopoietin-like 4
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC023647
Gene Symbol ANGPTL4
Gene ID (NCBI) 51129
RRIDAB_2882790
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BY76
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three isoforms, 45 kDa, 41 kDa and 27 kDa.

Loading...
||
New chat Able
正在加载,请稍候...