ANKRD17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ANKRD17 Polyclonal antibody, PBS Only (27701-1-PBS)

• 

  WB analysis using 27701-1-AP (same clone as 27701-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27701-1-AP (ANKRD17 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27701-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27701-1-AP (same clone as 27701-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27701-1-AP (ANKRD17 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27701-1-PBS in a different storage buffer formulation.

ANKRD17 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27701-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

NY BR 16, KIAA0697, GTAR, ankyrin repeat domain 17

---

Product Information

27701-1-PBS targets ANKRD17 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26767

  Product name: Recombinant human ANKRD17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1553-1684 aa of NM_001286771

  Sequence: MGSHGKRNNTITTTSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRISSCSDESSNSNSSRKSDNHSPAVVTTTVSSKKQPSVLVTFPKEERKSVSGKASIKLSETISEGTS

• Full Name: ankyrin repeat domain 17
• Calculated Molecular Weight: 274 kDa
• Observed Molecular Weight: 270-300 kDa
• GenBank Accession Number: NM_001286771
• Gene Symbol: ANKRD17
• Gene ID (NCBI): 26057
• RRID: AB_3085987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75179
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANKRD17 belongs to the family of ankyrin repeat-containing proteins, and contains two distinct arrays of ankyrin repeats in its amino-terminal region. It also contains a nuclear export signal, nuclear localization signal, and a cyclin-binding RXL motif. Localization of this protein to the nucleus has been shown experimentally, and interactions between this protein and cyclin-dependent kinase 2 have been observed.