Tested Applications
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lung cancer tissue, mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12652-1-AP targets TMEM16A/DOG1 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3320 Product name: Recombinant human ANO1,DOG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 541-712 aa of BC027590 Sequence: LVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQEIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL Predict reactive species |
| Full Name | anoctamin 1, calcium activated chloride channel |
| Calculated Molecular Weight | 986 aa, 114 kDa |
| Observed Molecular Weight | 114 kDa |
| GenBank Accession Number | BC027590 |
| Gene Symbol | TMEM16A |
| Gene ID (NCBI) | 55107 |
| RRID | AB_2722560 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5XXA6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist. The immunogen is the C-terminal of ANO1. This antibody can recognize isoform1 and isoform2 of human ANO1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM16A/DOG1 antibody 12652-1-AP | Download protocol |
| IHC protocol for TMEM16A/DOG1 antibody 12652-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-TMEM16A/ANO1 antibody (catalog no. 12652-1-AP) has 14 total citations across journals including Cancer Research, Cell Discovery, Cell Death & Disease, Cell Signaling, Journal of Biological Chemistry, eLife, and PLoS ONE. Research fields span cancer metastasis, proteogenomics, intestinal barrier dysfunction, renal fibrosis, esophageal carcinoma, chronic constipation, vascular smooth muscle physiology, embryonic development, and male fertility.
| Species | Application | Title |
|---|---|---|
Cancer Res ANO1 reprograms cholesterol metabolism and the tumor microenvironment to promote cancer metastasis
| ||
Cell Death Dis Dual role of Ca2+-activated Cl- channel transmembrane member 16A in lipopolysaccharide-induced intestinal epithelial barrier dysfunction in vitro. | ||
Cell Signal TMEM16A inhibits renal tubulointerstitial fibrosis via Wnt/β-catenin signaling during hypertension nephropathy | ||
RSC Med Chem Pt(iv) derivatives of cisplatin and oxaliplatin bearing an EMT-related TMEM16A/COX-2-selective dual inhibitor against colorectal cancer cells HCT116 | ||
Biomed Pharmacother Calcium-activated chloride channel is involved in the onset of diarrhea triggered by EGFR tyrosine kinase inhibitor treatment in rats. |
Reviews
What customers say
Both reviewers used this antibody for immunofluorescence targeting ANO1/Tmem16a and reported strong results. One user achieved good staining in mouse colonic tissues at 1:100 dilution for both IF and IHC, noting it outperformed other ANO1 antibodies they had tried. The second user highlighted that ANO1 antibodies are notoriously difficult for IF, yet this one delivered encouraging results on the first attempt. Both expressed high satisfaction and planned to explore additional applications such as western blotting and brain tissue studies.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shabana (Verified Customer) (07-23-2025) | I have used Tmem16a (Ano1) for IF using mouse colonic tissues. There were major concerns about this antibody in giving compromised staining, this antibody from Proteintech gave good staining in the gut tissues at 1:100 dilution. The IHC results are very promising, and I would use this to look for the expression of Tmem16a in brain and blood-brain-barrier dysfunction. Will also try for western blotting.
|
Shihab (Verified Customer) (09-17-2021) | I have used this for immunofluorescent stainings in a certain tissue type (cannot disclose) and despite ANO1 antibodies being notorious for such stainings (we have found only 1 other to work properly), this antibody gave very encouraging results on the first attempt at staining. With further optimisation, we should be able to get a decent staining pattern. Very impressed. I will also be trying this in various other applications. Very promising antibody.
|
