Annexin A11 Polyclonal antibody

• 

  WB analysis of HeLa using 10479-2-AP

  HeLa (WT and ANXA11 KO) lysates prepared with RIPA buffer, 50 μg protein loaded. 10479-2-AP incubated at 1:2000 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown on right. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  WB analysis using 10479-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10479-2-AP (Annexin A11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 10479-2-AP

  WB result of Annexin A11 antibody (10479-2-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin A11 transfected A431 cells.

• 

  IP experiment of HeLa using 10479-2-AP

  HeLa lysates prepared and IP of ANXA11 performed using 1.0 μg of 10479-2-AP coupled to protein A- Sepharose beads. The Ponceau stained transfers of each blot are shown. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IP experiment of HeLa using 10479-2-AP

  IP result of anti-Annexin A11 (IP:10479-2-AP, 4ug; Detection:10479-2-AP 1:30000) with HeLa cells lysate 1480 ug.

• 

  IHC staining of human ovary tumor using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 10479-2-AP (Annexin A11 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 10479-2-AP (Annexin A11 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 10479-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Annexin A11 antibody (10479-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 10479-2-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Annexin A11 antibody (10479-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 10479-2-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Annexin A11 antibody (10479-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Annexin A11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10479-2-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ANXA11, 56 kDa autoantigen, Annexin 11, Annexin XI, Annexin-11

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, mouse uterus tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human kidney tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 8 publications below
• IF: See 6 publications below
• CoIP: See 1 publications below

Product Information

10479-2-AP targets Annexin A11 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0729

  Product name: Recombinant human ANXA11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC007564

  Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT

• Full Name: annexin A11
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56-60 kDa
• GenBank Accession Number: BC007564
• Gene Symbol: Annexin A11
• Gene ID (NCBI): 311
• RRID: AB_2057171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50995
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	Sci Transl Med; Mutations in the vesicular trafficking protein annexin A11 are associated with amyotrophic lateral sclerosis.; Authors - Bradley N Smith
human	IHC,IF	Ann Neurol; A Novel Multisystem Proteinopathy Caused by a Missense ANXA11 Variant.; Authors - Tauana Bernardes Leoni
mouse	WB	Oncotarget; ANXA11 regulates the tumorigenesis, lymph node metastasis and 5-fluorouracil sensitivity of murine hepatocarcinoma Hca-P cells by targeting c-Jun.; Authors - Shuqing Liu ; KD Validated
human	WB,IF	FASEB J; Non-canonical RNA-binding protein ANXA11 regulates microRNA resorting into small extracellular vesicles to mediate cisplatin resistance; Authors - Yifan Zhang
mouse	WB	Biomed Pharmacother; Annexin A11 knockdown inhibits in vitro proliferation and enhances survival of Hca-F cell via Akt2/FoxO1 pathway and MMP-9 expression.; Authors - Shuqing Liu ; KD Validated
human	WB,IHC	Neurobiol Aging; Genetic screening of ANXA11 revealed novel mutations linked to amyotrophic lateral sclerosis.; Authors - Elisa Teyssou