Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Annexin A11 Polyclonal antibody

Annexin A11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

ANXA11, 56 kDa autoantigen, Annexin 11, Annexin XI, Annexin-11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Annexin A11 in ?

Tested Applications

Positive WB detected inA431 cells, HeLa cells, mouse uterus tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman ovary tumor tissue, human breast cancer tissue, human kidney tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10479-2-AP targets Annexin A11 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0729

Product name: Recombinant human ANXA11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC007564

Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT

Predict reactive species
Full Name annexin A11
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 56-60 kDa
GenBank Accession NumberBC007564
Gene Symbol Annexin A11
Gene ID (NCBI) 311
RRIDAB_2057171
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50995
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).

Protocols

Product Specific Protocols
IF protocol for Annexin A11 antibody 10479-2-APDownload protocol
IHC protocol for Annexin A11 antibody 10479-2-APDownload protocol
IP protocol for Annexin A11 antibody 10479-2-APDownload protocol
WB protocol for Annexin A11 antibody 10479-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Annexin A11 Polyclonal antibody (Cat# 10479-2-AP) has accumulated 27 citations published in journals including Nature, Nature Communications, Science Translational Medicine, Acta Neuropathologica, Developmental Cell, Annals of Neurology, FASEB Journal, Oncotarget, Brain Pathology, and PNAS. Associated research fields encompass neurodegenerative diseases (FTLD-TDP, ALS), oncology (hepatocarcinoma, colorectal cancer, breast cancer), plasma membrane repair, protein aggregation and condensates, muscular dystrophy, and chemoresistance.

SpeciesApplicationTitle
Human

Nature

Heteromeric amyloid filaments of ANXA11 and TDP-43 in FTLD-TDP Type C

Authors - Diana Arseni

Nat Commun

ANXA11 biomolecular condensates facilitate protein-lipid phase coupling on lysosomal membranes

Authors - Jonathon Nixon-Abell
humanIHC,IF

Sci Transl Med

Mutations in the vesicular trafficking protein annexin A11 are associated with amyotrophic lateral sclerosis.

Authors - Bradley N Smith
humanIHC,IF

Acta Neuropathol

Expanding the spectrum of annexin A11 proteinopathy in frontotemporal lobar degeneration and motor neuron disease.

Authors - Nikhil B. Ghayal
humanWB,IF

Acta Neuropathol

Annexin A11 aggregation in FTLD-TDP type C and related neurodegenerative disease proteinopathies

Authors - John L Robinson

Dev Cell

The ALS- and FTD-associated proteins annexin A11 and CHMP2B act sequentially in plasma membrane repair.

Authors - Catherine M. Heffner
Loading...
||
New chat

Able™

正在加载,请稍候...