Annexin A11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Annexin A11 Polyclonal antibody (10479-2-AP)

• Featured Product
• KD/KO Validated

Annexin A11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10479-2-AP Copied!

Publications (27)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ANXA11, 56 kDa autoantigen, Annexin 11, Annexin XI, Annexin-11

• 

  WB analysis of HeLa using 10479-2-AP

  HeLa (WT and ANXA11 KO) lysates prepared with RIPA buffer, 50 μg protein loaded. 10479-2-AP incubated at 1:2000 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown on right. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  WB analysis using 10479-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10479-2-AP (Annexin A11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 10479-2-AP

  WB result of Annexin A11 antibody (10479-2-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin A11 transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10479-2-AP

  HeLa lysates prepared and IP of ANXA11 performed using 1.0 μg of 10479-2-AP coupled to protein A- Sepharose beads. The Ponceau stained transfers of each blot are shown. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IP experiment of HeLa using 10479-2-AP

  IP result of anti-Annexin A11 (IP:10479-2-AP, 4ug; Detection:10479-2-AP 1:30000) with HeLa cells lysate 1480 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10479-2-AP (Annexin A11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 10479-2-AP (Annexin A11 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10479-2-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 10479-2-AP (Annexin A11 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10479-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Annexin A11 antibody (10479-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10479-2-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Annexin A11 antibody (10479-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10479-2-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Annexin A11 antibody (10479-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Annexin A11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, mouse uterus tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human kidney tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10479-2-AP targets Annexin A11 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0729

  Product name: Recombinant human ANXA11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC007564

  Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT

• Full Name: annexin A11
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56-60 kDa
• GenBank Accession Number: BC007564
• Gene Symbol: Annexin A11
• Gene ID (NCBI): 311
• RRID: AB_2057171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50995
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).

Publications

What published studies show

The Annexin A11 Polyclonal antibody (Cat# 10479-2-AP) has accumulated 27 citations published in journals including Nature, Nature Communications, Science Translational Medicine, Acta Neuropathologica, Developmental Cell, Annals of Neurology, FASEB Journal, Oncotarget, Brain Pathology, and PNAS. Associated research fields encompass neurodegenerative diseases (FTLD-TDP, ALS), oncology (hepatocarcinoma, colorectal cancer, breast cancer), plasma membrane repair, protein aggregation and condensates, muscular dystrophy, and chemoresistance.

Automatically generated from the 27 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human		Nature; Heteromeric amyloid filaments of ANXA11 and TDP-43 in FTLD-TDP Type C; Authors - Diana Arseni
		Nat Commun; ANXA11 biomolecular condensates facilitate protein-lipid phase coupling on lysosomal membranes; Authors - Jonathon Nixon-Abell
human	IHC,IF	Sci Transl Med; Mutations in the vesicular trafficking protein annexin A11 are associated with amyotrophic lateral sclerosis.; Authors - Bradley N Smith
human	IHC,IF	Acta Neuropathol; Expanding the spectrum of annexin A11 proteinopathy in frontotemporal lobar degeneration and motor neuron disease.; Authors - Nikhil B. Ghayal
human	WB,IF	Acta Neuropathol; Annexin A11 aggregation in FTLD-TDP type C and related neurodegenerative disease proteinopathies; Authors - John L Robinson
		Dev Cell; The ALS- and FTD-associated proteins annexin A11 and CHMP2B act sequentially in plasma membrane repair.; Authors - Catherine M. Heffner