• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Annexin A11 Polyclonal antibody

Annexin A11 Polyclonal Antibody for IF/ICC
Cat No. CL488-10479

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

ANXA11, ANX11, Annexin-11, Annexin XI, Annexin 11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10479 targets Annexin A11 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0729

Product name: Recombinant human ANXA11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC007564

Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT

Predict reactive species
Full Name annexin A11
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 56-60 kDa
GenBank Accession NumberBC007564
Gene Symbol Annexin A11
Gene ID (NCBI) 311
RRIDAB_3083879
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50995
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Annexin A11 antibody CL488-10479Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...