Annexin V Polyclonal antibody

• 

  WB analysis using 11060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 11060-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 11060-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 11060-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 11060-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 11060-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11060-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig heart using 11060-1-AP

  pig heart tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 11060-1-AP

  pig liver tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 11060-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11060-1-AP

  IP result of anti-Annexin V (IP:11060-1-AP, 3ug; Detection:11060-1-AP 1:500) with HeLa cells lysate 3000ug.

• 

  IP experiment of mouse liver using 11060-1-AP

  IP result of anti-Annexin V (IP:11060-1-AP, 4ug; Detection:11060-1-AP 1:600) with mouse liver tissue lysate 7000ug.

• 

  IHC staining of human spleen using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11060-1-AP (Annexin V antibody at dilution of 1:400 (under 10x lens).

• 

  IHC staining of human spleen using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11060-1-AP (Annexin V antibody at dilution of 1:400 (under 40x lens).

• 

  IHC staining of human placenta using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11060-1-AP (Annexin V antibody at dilution of 1:400 (under 10x lens).

• 

  IHC staining of human placenta using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11060-1-AP (Annexin V antibody at dilution of 1:400 (under 40x lens).

• 

  IF Staining of HeLa using 11060-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Annexin V antibody (11060-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HeLa using 11060-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Annexin V antibody (11060-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of HeLa using 11060-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Annexin V Polyclonal antibody (11060-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

Annexin V Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11060-1-AP

Publications(36)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

---

Tested Applications

• Positive WB detected in: HEK-293T cells, A431 cells, C6 cells, HeLa cells, HepG2 cells, human heart tissue, human lung tissue, human placenta tissue, human skeletal muscle tissue, NIH/3T3 cells, pig heart tissue, pig liver tissue, K-562 cells, NIH?3T3 cells, C2C12 cells
• Positive IP detected in: HeLa cells, mouse liver tissue
• Positive IHC detected in: human spleen tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 23 publications below
• IHC: See 7 publications below
• IF: See 9 publications below
• IP: See 1 publications below

Product Information

11060-1-AP targets Annexin V in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1538

  Product name: Recombinant human ANXA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC001429

  Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

• Full Name: annexin A5
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC018671
• Gene Symbol: Annexin V
• Gene ID (NCBI): 308
• RRID: AB_2057585
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08758
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); Isolation and Comprehensive Analysis of Cochlear Tissue-Derived Small Extracellular Vesicles; Authors - Pei Jiang
	WB	Nucleic Acids Res; Short DNA/RNA heteroduplex oligonucleotide interacting proteins are key regulators of target gene silencing.; Authors - Ken Asada
human	IF	Matrix Biol; Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility.; Authors - Emna Ouni
		Mol Cancer Res; DNA Methyltransferase 3B-Mediated Intratumoral Heterogeneity and Therapeutic Targeting in Breast Cancer Recurrence and Metastasis; Authors - Jae Young So
mouse,human	WB,IHC,IF	Cell Death Dis; Annexin A5 regulates hepatocarcinoma malignancy via CRKI/II-DOCK180-RAC1 integrin and MEK-ERK pathways.; Authors - Xujuan Sun ; KD Validated
human	IHC	Front Cell Dev Biol; Time-Resolved Extracellular Matrix Atlas of the Developing Human Skin Dermis.; Authors - Mansheng Li