Annexin V Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Annexin V Polyclonal antibody (11060-1-AP)

• Featured Product
• KD/KO Validated

Annexin V Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11060-1-AP Copied!

Publications (49)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

• 

  WB analysis using 11060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 11060-1-AP

  WB result of Annexin V antibody (11060-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin V transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 11060-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 11060-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 11060-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11060-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 11060-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 11060-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 11060-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig heart using 11060-1-AP

  pig heart tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig liver using 11060-1-AP

  pig liver tissue were subjected to SDS PAGE followed by western blot with 11060-1-AP (Annexin V antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11060-1-AP

  IP result of anti-Annexin V (IP:11060-1-AP, 3ug; Detection:11060-1-AP 1:500) with HeLa cells lysate 3000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 11060-1-AP

  IP result of anti-Annexin V (IP:11060-1-AP, 4ug; Detection:11060-1-AP 1:600) with mouse liver tissue lysate 7000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11060-1-AP (Annexin V antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11060-1-AP (Annexin V antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11060-1-AP (Annexin V antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11060-1-AP (Annexin V antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11060-1-AP (Annexin V antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 11060-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11060-1-AP (Annexin V antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11060-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Annexin V antibody (11060-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 11060-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Annexin V Polyclonal antibody (11060-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Annexin V in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, A431 cells, C6 cells, HeLa cells, HepG2 cells, human heart tissue, human lung tissue, human placenta tissue, human skeletal muscle tissue, NIH/3T3 cells, pig heart tissue, pig liver tissue, K-562 cells, NIH?3T3 cells, C2C12 cells
• Positive IP detected in: HeLa cells, mouse liver tissue
• Positive IHC detected in: human spleen tissue, human placenta tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11060-1-AP targets Annexin V in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1538

  Product name: Recombinant human ANXA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC001429

  Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

• Full Name: annexin A5
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC018671
• Gene Symbol: Annexin V
• Gene ID (NCBI): 308
• RRID: AB_2057585
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08758
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Publications

What published studies show

Anti-Annexin A5 antibody (Cat# 11060-1-AP) has 49 citations published in journals including Exploration, J Extracell Vesicles, Redox Biology, Nucleic Acids Research, Advanced Science, Cell Death & Disease, J Biol Chem, Endocrinology, BMC Cancer, and Sci Rep. Associated research fields encompass oncology (hepatocellular, gastric, breast, pancreatic cancers), extracellular vesicle/exosome biology, cardiology, neuroscience, pulmonary fibrosis, bone biology, reproductive medicine, and immunology.

Automatically generated from the 49 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB,IHC,IF	Exploration (Beijing); Caffeic Acid Acts as a Potent Senomorphic and Alleviates Inflammation and Lung Fibrosis by Covalently Targeting Annexin A5 Protein in Mice.; Authors - Yinhua Zhu ; KD Validated
mouse	WB	J Extracell Vesicles; Baohuoside I chemosensitises breast cancer to paclitaxel by suppressing extracellular vesicle/CXCL1 signal released from apoptotic cells; Authors - Shengqi Wang
human	IF	Redox Biol; Evidence for alcohol-mediated hemolysis and erythrophagocytosis.; Authors - Chaowen Zheng
	WB	Nucleic Acids Res; Short DNA/RNA heteroduplex oligonucleotide interacting proteins are key regulators of target gene silencing.; Authors - Ken Asada
human	WB	J Exp Clin Cancer Res; Musashi2 promotes EGF-induced EMT in pancreatic cancer via ZEB1-ERK/MAPK signaling; Authors - Weiwei Sheng
mouse	WB	Adv Sci (Weinh); Discovery of Balasubramide Derivative with Tissue-Specific Anti-Inflammatory Activity Against Acute Lung Injury by Targeting VDAC1; Authors - Jin-Qian Song