• Featured Product
  • KD/KO Validated

Annexin V Polyclonal antibody

Annexin V Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 11060-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, A431 cells, C6 cells, HeLa cells, HepG2 cells, human heart tissue, human lung tissue, human placenta tissue, human skeletal muscle tissue, NIH/3T3 cells, pig heart tissue, pig liver tissue, K-562 cells, NIH?3T3 cells, C2C12 cells
Positive IP detected inHeLa cells, mouse liver tissue
Positive IHC detected inhuman spleen tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11060-1-AP targets Annexin V in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1538

Product name: Recombinant human ANXA5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-320 aa of BC001429

Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Predict reactive species
Full Name annexin A5
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC018671
Gene Symbol Annexin V
Gene ID (NCBI) 308
RRIDAB_2057585
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08758
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Protocols

Product Specific Protocols
FC protocol for Annexin V antibody 11060-1-APDownload protocol
IF protocol for Annexin V antibody 11060-1-APDownload protocol
IHC protocol for Annexin V antibody 11060-1-APDownload protocol
IP protocol for Annexin V antibody 11060-1-APDownload protocol
WB protocol for Annexin V antibody 11060-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Adv Sci (Weinh)

Isolation and Comprehensive Analysis of Cochlear Tissue-Derived Small Extracellular Vesicles

Authors - Pei Jiang
WB

Nucleic Acids Res

Short DNA/RNA heteroduplex oligonucleotide interacting proteins are key regulators of target gene silencing.

Authors - Ken Asada
humanIF

Matrix Biol

Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility.

Authors - Emna Ouni

Mol Cancer Res

DNA Methyltransferase 3B-Mediated Intratumoral Heterogeneity and Therapeutic Targeting in Breast Cancer Recurrence and Metastasis

Authors - Jae Young So
mouse,humanWB,IHC,IF

Cell Death Dis

Annexin A5 regulates hepatocarcinoma malignancy via CRKI/II-DOCK180-RAC1 integrin and MEK-ERK pathways.

Authors - Xujuan Sun
  • KD Validated
humanIHC

Front Cell Dev Biol

Time-Resolved Extracellular Matrix Atlas of the Developing Human Skin Dermis.

Authors - Mansheng Li
Loading...
||
New chat Able
正在加载,请稍候...