VAP1/AOC3 Monoclonal antibody, PBS Only

• 

  WB analysis of human ileum using 66834-1-Ig (same clone as 66834-1-PBS)

  human ileum tissue were subjected to SDS PAGE followed by western blot with 66834-1-Ig (AOC3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66834-1-Ig (same clone as 66834-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66834-1-Ig (AOC3 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66834-1-Ig (same clone as 66834-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66834-1-Ig (AOC3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66834-1-Ig (same clone as 66834-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66834-1-Ig (AOC3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66834-1-Ig (same clone as 66834-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66834-1-Ig (AOC3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66834-1-Ig (same clone as 66834-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using AOC3 antibody (66834-1-Ig, Clone: 2A6G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66834-1-Ig (same clone as 66834-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using AOC3 antibody (66834-1-Ig, Clone: 2A6G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66834-1-PBS in a different storage buffer formulation.

VAP1/AOC3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66834-1-PBS

Clone No.2A6G3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

AOC3, VAP1, 2A6G3, Amine oxidase [copper-containing] 3, Amine oxidase copper-containing 3

---

Product Information

66834-1-PBS targets VAP1/AOC3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5908

  Product name: Recombinant human AOC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 408-763 aa of BC050549

  Sequence: ATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN

• Full Name: amine oxidase, copper containing 3 (vascular adhesion protein 1)
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC050549
• Gene Symbol: AOC3
• Gene ID (NCBI): 8639
• RRID: AB_2882177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16853
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AOC3(membrane primary amine oxidase) is also name as copper amine oxidase, HPAO, SSAO, VAP1 and belongs to the copper/topaquinone oxidase family. It is expressed on the surface of endothelial cells and is involved in leukocyte trafficking between blood and tissues under physiologic and pathologic conditions (PMID:17947691). AOC3 is highly expressed in adipocytes and smooth muscle cells and it can be N- and O-glycosylated (PMID:16046623). AOC3 has molecular mass of 70-90kD, and can exsit as a homodimer(165-185kD) and trimer(240~260kD) (PMID:10595925, 8625974).